KEGG   Cycloclasticus zancles: CYCME_2102Help
Entry
CYCME_2102        CDS       T02780                                 

Definition
Acetaldehyde dehydrogenase (acetylating)
Orthology
K18366  
acetaldehyde/propanal dehydrogenase [EC:1.2.1.10 1.2.1.87]
Organism
cza  Cycloclasticus zancles
Pathway
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:cza00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    CYCME_2102
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYCME_2102
   00650 Butanoate metabolism
    CYCME_2102
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CYCME_2102
   00622 Xylene degradation
    CYCME_2102
   00621 Dioxin degradation
    CYCME_2102
Enzymes [BR:cza01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CYCME_2102
    1.2.1.87  propanal dehydrogenase (CoA-propanoylating)
     CYCME_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2132846..2133751)
Genome map
AA seq 301 aa AA seqDB search
MAINCAMIGSGNIGTDLMAKLQRSPNLNPLWMVGIDPDSEGLLKAREAGLKTTHEGVDGL
IPHIEEDNIQIAFDATSAYVHGENNRKLQEKGVLVIDLTPAAIGPFCVPPVNLKEHVGEQ
EMNVNMVTCGGQATIPMVAAVSQVQAVEYGEIVATVASKSAGPGTRKNIDEFTRTTARAV
EEIGGAKKGKAIIILNPAEPPLIMRDTVHCLTEEEPDQKAITESVHAMIKEVQKYVPGYK
LKNGPIFDGHRVSIFLEVEGLGDYLPKYAGNLDIMTAAGTRTAEMFAEEIENGTLTLTKL
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaattgcgcaatgattggttccggtaatatcggcaccgacctaatggctaag
ctacaacgtagtccaaatttaaacccgctgtggatggtaggtattgatcctgactcagag
ggcttattaaaagctcgagaagcaggcctaaaaaccacgcatgaaggtgtagatggctta
attccacatattgaagaagataatatacaaattgcatttgatgcaacgtctgcatatgtg
catggagaaaataaccgtaaattgcaagaaaaaggcgtgttagtgattgatttaacgccg
gcagctattggcccattttgtgttccacctgttaacttgaaagagcacgtgggtgagcaa
gaaatgaacgttaatatggtgacctgtggtggccaagcaacgataccgatggtggctgct
gtgagtcaagttcaggcagtagagtacggtgagattgttgcaacagttgcatcaaaatca
gcaggcccgggcacacggaaaaatattgatgaattcacaaggacgacagcccgagccgtt
gaagaaattggtggtgctaagaaaggcaaagcgattattattttaaaccctgcagagcca
cctttaattatgagggatactgttcattgcttaactgaagaagaaccagatcaaaaagca
attacagaatcagttcacgcaatgattaaagaagtgcaaaaatatgtgccaggctataag
ttaaaaaatggaccaatttttgatggacatagagttagtatatttctagaggttgaaggg
ctaggagattaccttccaaagtatgccggtaatttggatattatgacggctgctgggaca
agaacagcagaaatgtttgccgaagagattgaaaacggcacactgacattaaccaaatta
gcttag

DBGET integrated database retrieval system