KEGG   Delftia acidovorans: Daci_0130Help
Entry
Daci_0130         CDS       T00620                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Daci_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
140921..141862
Genome map
AA seq 313 aa AA seqDB search
MNMADGFDAVQRSEPATGLDNVCVTEHEFVMPGTGVAARTGVLLVHGLTGTPAEMRLLAK
GLNKQGFTVYAVQLAGHCGSMEDLVDTRWTDWLASVEAGLQRLSQHMDHVVVGGLSMGAV
LSLAVAQRHPDKVDGVCALSTTFRYDGWSIPFYTRLAFLLPLFRALGIGRHSVFMKQPPY
GIKDEALRARVVEQMHSGDSAAAGLPGNPWWSIIELRRLSAHVLARLPQLRSPCLVIHAR
NDDISSVANAHDIVHGASQAHVELVLLDNSYHMVTIDRDRRTVIARTTEFVARIASGAAP
REVRAAEAARHGQ
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaacatggccgatggattcgacgccgttcagcgcagcgagcctgccacggggctggac
aacgtttgcgtgaccgagcatgaattcgtcatgcccggcacgggcgtggccgcgcgcacc
ggcgtgctgctggtgcacgggcttacgggcacgccggccgagatgcgcctgctggccaag
gggctgaacaagcagggcttcaccgtctatgcggtccagctggccggccattgcggcagc
atggaagatctcgtggacacgcgctggaccgactggctggccagcgtggaggccggcctg
cagcggctgtcgcagcacatggaccatgtggtggtcggaggcctgtccatgggcgccgtg
ctctccctggccgtggcccagcgccaccccgacaaggtggacggtgtctgcgccctgtcc
accaccttccgctacgacggctggagcattcccttctacacgcgcctggcctttttgctg
ccgctgttccgcgcactgggcattggccgccacagcgtgttcatgaagcagccgccctac
ggcatcaaggacgaggccctgcgcgcgcgcgtggtcgagcaaatgcattcgggcgacagc
gcggcggccggcctgccgggcaatccctggtggtccatcatcgagctgcgccgcctctcg
gcccatgtgctggcgcgactgccccagctgcgctcgccctgcctggtcatccatgcgcgc
aacgacgacatctcgtcggtggccaacgcccatgacatcgtgcatggcgccagccaggcc
catgtcgagctggtgctgctggacaacagctaccacatggtcaccatagaccgcgaccgc
cgcaccgtgatcgcgcgcaccaccgaattcgtggcgcgcatcgccagcggtgccgccccc
cgcgaggtgcgggctgcggaggccgcacggcatgggcagtga

DBGET integrated database retrieval system