KEGG   Delftia acidovorans: Daci_0183Help
Entry
Daci_0183         CDS       T00620                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Daci_0183
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_0183
  Lipid metabolism
   00071 Fatty acid degradation
    Daci_0183
  Amino acid metabolism
   00350 Tyrosine metabolism
    Daci_0183
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Daci_0183
   00626 Naphthalene degradation
    Daci_0183
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Daci_0183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
207700..208830
Genome map
AA seq 376 aa AA seqDB search
MKTRAAVLTRTGAAAPYADSRPLEIWEVDLAPPGPGEVLVKVAAAGVCHSDLSIINGDRP
RDTPIVLGHEAAGVIQALGEGVTDLEVGDHVVMLFVPGCGNCQPCAEGRPVLCEPAGQAG
VAGTLLSGARRLSRNGQPISHFVGVSAFAEHAVLSRRGVHRIDKSVPLELAALFGCAVMT
GVGAVANTARVSPGQSVAVVGLGGVGLSSVMGAAAAGAARVVAVDLNADKLAMAREFGAT
DIVNAGDEDAVKQVRELTGGGVDHAFEMVGSAKALEMAYRITRRGGQTVTAGLPSSAQAI
SLPVWHLVAEERTLKGCYMGSCVPRRDIDRYLALHAAGRLPVDRLVTGHLTLDQINEGFD
RLARGEAIRQIIRMDA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaagacacgcgccgccgtactcacgagaacgggcgcagccgcgccctatgccgacagc
cgcccgctggagatctgggaggtggacctggcgccgcccggccccggcgaggtgctggtc
aaggtggccgccgcaggcgtgtgccactccgacctgtccatcatcaacggcgaccgtccg
cgcgacacgcccatcgtgctcggccacgaggccgcaggcgtgatccaggcgctgggcgag
ggtgtgaccgacctggaggtgggcgaccacgtggtcatgctcttcgtgcccggctgcggc
aactgccagccctgcgccgaaggccggcccgtgctgtgcgagcccgcaggccaggccggc
gtggcgggcaccctgctgtcgggcgccaggcggctgtcgcgcaatggccagcccatctcg
cacttcgtcggcgtctcggcctttgccgagcatgccgtgctctcgcgccgcggcgtgcac
cgcatcgacaagtcggtgccgctggagctggccgcgctgttcggctgcgccgtgatgacc
ggcgtgggcgcggtggccaataccgccagagtgagccccggccagagcgtggccgtggtg
gggctgggcggcgtgggcctgtcctcggtgatgggcgcggcggcggcgggcgcggcccgc
gtggtggccgtggacctcaatgccgacaagctggccatggcgcgcgaattcggcgccacc
gatatcgtcaacgctggcgacgaggatgccgtcaagcaggtgcgcgagctgacaggcggc
ggcgtggaccatgccttcgagatggtgggatcggccaaggcactggagatggcctaccgc
atcacgcggcgcggcggccagaccgtgacggcgggcctgccttccagcgcccaggcgatc
agcctgccggtctggcacctggtggccgaggagcgcacgctcaagggctgctacatgggc
agctgcgtgccgcgccgcgacatcgaccgctacctggccctgcatgcggccggcaggctg
cccgtggaccgcctggtcaccggccacctgacgctggaccagatcaacgagggcttcgac
cgcctggcgcgtggcgaggccatacgccagatcatccgcatggatgcctga

DBGET integrated database retrieval system