KEGG   Delftia acidovorans: Daci_0522Help
Entry
Daci_0522         CDS       T00620                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
dac  Delftia acidovorans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dac00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Daci_0522
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Daci_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
562874..565081
Genome map
AA seq 735 aa AA seqDB search
MSPRPRSRTVDTATLDLFDERPGDDSPGGETPGDASLGGKPPGAVPPDTNELLALLRRWA
DAGLLRRLDAALASFVAGQDAQAGPALLVAAALLAQMEGRGHSCLPLAPLAGNPNDVLAW
PAEALPAQQALWQILPARLSGWVAALGASPVVRVVGDAGQDGGEDLGQPLVLAGADGPAP
LLYLRRYWDYERAVAIHVIQRTAVQAVAAQPLDEALARHWLDRLFPPAAGGGPVDWQKLA
CALALRGRLSVITGGPGTGKTYTAARLLALLFATAPDAGQLRVALAAPTGKAAARLKQSI
DGALLQLQGSMGGEIDLAGLVQRMGAARTLHSMLGARPDTRHWGFHAGRQLDVDVLIVDE
ASMVHLEMMAALLEALPAGARLVLLGDKDQLASVEAGAVLGDLCRDAQAGRYLPDTLDYA
LRVADQAVPPQFAAPAGDRPPALAQHTVMLRESRRFGGPIGQLARAVNAGHAAQAQALLD
AGTQGGTHSELWERQGGGVQAVTELAVGGRGGLASYALYARALQNRPAADGDYEAAHRAW
VIDVLQAFERFRLLCAVREGDWGVSGLNRAVEQALEAQGAIRRSGEWYAGRPVMVTRNDA
QLGVFNGDIGIALPGGSQGGSHGGSQGGPQGGPGQPLRVYFLQGDELRSVGVSRLAHVET
AFAMTVHKSQGSEFEHTALVLPSRGGSVLGRELVYTGITRARQAFSLFSEVPGLLASAVG
SPTQRASGLLRWLQD
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atgagcccgcgcccccgttcgcggaccgtcgatacggccacgctggatctgttcgacgaa
cggccgggcgacgactcgccgggcggcgaaacgccaggcgacgcatcgctgggcggcaaa
ccgccgggcgccgtgccgccagacaccaatgaactgctggccctgctgcgccgctgggcc
gatgccggcctgctgcggcgcctggatgcggcgctggcctcattcgtcgccgggcaggat
gcgcaggccgggcccgccttgctggtggcggccgcgctgctggcgcagatggaggggcgc
ggccacagctgcctgcccctggcaccgctggccggcaaccccaacgacgtgctggcctgg
cccgccgaggcgctgcccgcgcagcaggccctgtggcagatactgcccgcgcgcctgtcc
ggctgggtggctgcgctgggtgccagccccgtggtgcgcgtggtcggcgacgcgggccag
gatggcggcgaggaccttggccagcccctggtgctggccggtgccgacggccccgcgccg
ctgctgtacctgcgccgctactgggactacgagcgcgccgtggccatccatgtcatccag
cgcacggcggtgcaggccgtggccgcccagccgctggacgaagccctggcccgccactgg
ctggaccgcctgttcccgcctgcggcgggaggcggccccgtggactggcagaagctggcc
tgcgcgctggcgctgcgcggccggctgtcggtgatcacgggcggccccggcaccggcaag
acctataccgccgcgcggctgctggccctgctgtttgccacggcgcccgacgccggccag
ctgcgcgtggccctggccgcccccacgggcaaggcggctgcgcgcctgaagcaatcgatt
gacggggccttgctgcaattgcagggcagcatgggcggcgagatcgacctggcgggcctg
gtgcagcgcatgggcgcggcgcgcaccctgcactccatgctgggcgcgcggcccgatacg
cggcactggggattccatgcgggccggcaactggacgtggatgtcctcatcgtcgatgag
gcctccatggtccacctggagatgatggcggcgctgctggaggcactgccggccggcgcc
cgcctggtgctgctgggcgacaaggaccagctggcatcggtggaggcgggcgccgtgctg
ggcgacctgtgccgcgatgcccaggccggacgctacctgccggacacgctggactacgcg
ctgcgcgtggccgaccaggcggtgccgccgcagttcgcggcgccggcaggcgaccgtcct
ccggctcttgcacagcacaccgtcatgctgcgcgaaagccggcgcttcggtggccccatc
ggccagttggcgcgcgccgtgaatgccggccacgccgcgcaggcccaagccttgctcgat
gccggcacgcaaggcggtacgcactccgaactctgggagcgccagggcggcggcgtgcag
gccgtgaccgaactggccgtgggtgggcgtggcggcctggccagctatgcgctgtatgcc
agggcgcttcaaaacaggccggctgcggacggcgactacgaggccgcgcaccgggcctgg
gtgatcgatgtgctgcaggccttcgagcgcttccggctgctgtgcgccgtgcgcgagggg
gactggggcgtgtccggcctcaaccgggcggtggagcaggccctggaagcgcagggcgcc
atccgccgcagcggcgaatggtatgcgggccggcccgtcatggtcacgcgcaacgatgcg
cagctgggcgtgttcaacggtgacatcggcattgcgctgccgggtgggtcgcagggcggg
tcgcatggcgggtcacaggggggcccgcagggtgggcccgggcagccgctgcgcgtgtac
ttcctgcagggtgacgagctgcgctcggtcggtgtcagccgcctggcccatgtggagacc
gccttcgccatgacggtgcacaagagccagggctcggagttcgagcacacggccctggtg
ctgccctcgcgcggcggcagcgtgctggggcgcgagctggtctacaccggcatcacgcgc
gcccgccaggccttctcgctgttctccgaggtgccgggcctgctggcctcggccgttggc
agccccacgcagcgcgccagcgggctgttgcgctggctgcaggactga

DBGET integrated database retrieval system