KEGG   Delftia acidovorans: Daci_0665Help
Entry
Daci_0665         CDS       T00620                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
dac  Delftia acidovorans
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daci_0665
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Daci_0665
   00630 Glyoxylate and dicarboxylate metabolism
    Daci_0665
Enzymes [BR:dac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Daci_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(737055..739247)
Genome map
AA seq 730 aa AA seqDB search
MTDRTQAHSLQVATELHRFINEQVLPGTGVAPEAFWKGFDAIVNDLAPRNAALLAERDRL
QTELDTWHKAHPGPITDMAGYQQFLTQIGYLVEQPKDAKATTTNVDAELAIQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAIGEDGGAEKGKGYNPVRGAKVIAFARDFLDQAA
PLASGSHKDAAGYRVEAGQLVVALKSGGTTGLKNTAQFVGYQGDAAAPSSVLLLNNGLHI
DIRIDKTTAIGQTDAAGVADVVVEAALSTILDLEDSVAAVDAEDKVVGYANWLGILKGTL
TETFDKGGKSMTRGLNADREYTGADGKPVKLHGRSLMFVRNVGHLMTNPAILWGNGKEIP
EGILDAMVTTAIAVHDIKGLGANGIRNSRTGSVYIVKPKMHGPAEAAFASELFGRVEKVL
GLPENTVKLGIMDEERRTSVNLKACIAAAASRVAFINTGFLDRTGDEMHTAMYAGPMVRK
ADMKGSAWLAAYERSNVLVGLGLGLRGKAQIGKGMWAMPDLMKAMLEQKIGHPKAGANTA
WVPSPTAATLHALHYHQVNVAEVQKQLEQTNADAERATILADLLQVPVVKEDKWSAAEKQ
QELDNNVQGILGYVVRWVDQGVGCSKVPDIHNVGLMEDRATLRISSQHIANWLQHGIVTE
AQVRETFERMAAVVDQQNAGDALYKPMAGHFDTSMAYQAACDLVFKGKEQPSGYTEPLLH
AWRLKVKAAA
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcgcacccaagcccacagcctgcaggtcgctacagagctgcaccgtttcatc
aatgaacaagtgctcccgggcaccggtgtcgctcccgaggcgttctggaaaggcttcgac
gcgatcgtcaacgatctggctcctcgcaatgccgccctgctggccgagcgcgaccgcctg
cagaccgagctggacacctggcacaaggcccatcccggccccatcaccgacatggccggc
taccagcaattcctgacgcagatcggctatctggtcgagcagcccaaggatgccaaggcc
accaccaccaatgtggatgcggaactggccatccaggccggtccccagctggtcgtgccc
attctcaacgcccgctatgcgctgaacgccgccaacgcgcgctggggttcgctgtatgac
gcgctgtacggcacggacgccatcggcgaagacggcggcgcggaaaagggcaagggctac
aaccccgtgcgcggcgccaaggtgatcgccttcgcacgtgatttcctggaccaggcagcc
ccgctggcatcgggctcgcacaaggatgccgccggctatcgcgtggaagctggccagctg
gtcgtcgcgctcaagagcggcggcaccacgggcctgaagaacaccgcccagttcgtcggc
taccagggcgatgccgcggcgccctcttccgtgctgctgctcaacaacggcctgcacatc
gacatccgcatcgacaagaccacggccatcggccagaccgatgccgccggcgtggccgac
gtggtggtcgaagccgccctgtccaccatcctggacctggaagactccgtggccgccgtg
gatgccgaagacaaggtggtgggctatgccaactggctgggcatcctcaagggcacgctg
accgaaaccttcgacaagggcggcaagagcatgacgcgcggactgaacgccgaccgcgag
tacacgggcgctgatggcaagcccgtcaagctgcatggccgttcgctgatgttcgtgcgc
aatgtcggccacctgatgaccaacccggccatcctctggggcaacggcaaggaaattccc
gagggcatcctggacgccatggtcaccacggccatcgccgtccacgacatcaagggtctg
ggcgccaacggcatccgcaactcgcgcacgggcagcgtctacatcgtcaagcccaagatg
cacggccccgcggaagccgccttcgccagcgagctgttcggccgcgtggaaaaggtcctg
ggcctgcccgagaacaccgtcaagctgggcatcatggacgaggagcgccgcaccagcgtc
aacctcaaggcctgcattgccgccgccgcatcgcgcgtggccttcatcaacaccggcttc
ctggaccgcacgggcgacgaaatgcacaccgccatgtatgccggccccatggtccgcaag
gccgacatgaagggcagcgcctggctggccgcctatgagcgcagcaacgtgctcgtgggc
ctgggcctgggcctgcgcggcaaggcgcagatcggcaagggcatgtgggccatgcccgac
ctgatgaaggccatgctggagcaaaagatcggccaccccaaggcaggcgccaataccgcc
tgggtgccctcgcccacggccgccacgctgcacgccctgcactaccaccaggtcaacgtg
gccgaagtgcaaaagcagctggagcagaccaatgccgacgccgagcgcgccaccatcctg
gccgacctgctgcaggtgcccgtggtcaaggaagacaagtggagcgccgccgagaagcag
caggagctggacaacaacgtccagggcatcctcggctatgtggtgcgctgggtggaccag
ggcgtgggctgctccaaggtgcccgacatccacaacgtgggcctgatggaagaccgcgcc
acgctgcgcatctccagccagcacatcgccaactggctgcagcacggcatcgtgaccgag
gcccaggtgcgcgagaccttcgagcgcatggccgccgtggttgaccagcagaacgcgggc
gatgcactgtacaagcccatggccggccacttcgacacctcgatggcctaccaggccgcc
tgtgacctggtcttcaagggcaaggagcaacccagtggctacaccgagcccctgctgcat
gcctggcgcctgaaggtcaaggcagccgcctga

DBGET integrated database retrieval system