KEGG   Delftia acidovorans: Daci_0869Help
Entry
Daci_0869         CDS       T00620                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dac  Delftia acidovorans
Pathway
dac00020  Citrate cycle (TCA cycle)
dac00640  Propanoate metabolism
dac00660  C5-Branched dibasic acid metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
Module
dac_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dac_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daci_0869
   00640 Propanoate metabolism
    Daci_0869
   00660 C5-Branched dibasic acid metabolism
    Daci_0869
Enzymes [BR:dac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Daci_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABX33515
UniProt: A9BQA5
Position
complement(974912..976072)
Genome map
AA seq 386 aa AA seqDB search
MKIHEYQGKDILRQFGVPVPRGIPAFTVQEAVEAAQKLGGPVWVVKAQIHAGGRGKGGGV
KVAKSIDDVKALAGQILGMQLVTHQTGPEGQKVRRLYIEDGADIQKEYYLSCVTDRGTQK
VAFIASSEGGMDIEEVAHSTPEKIITIFVDPLVGLTQAQGEELAKGIGMPADSTAQFIDI
CQKLYKCYMDTDASLVEINPLNRDSKGNVVALDAKFNFDANALFRLPEIVALRDLDEEDP
AEVEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATPEKVTE
AFKIMLKNPKVEGILVNIFGGIMKCDTIATGVITACKAVNLQVPLVVRMKGTNEELGKKM
LAESGLPIISADTMAEAATKIVEAVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcatgaataccaaggcaaggacatcttgcgtcagtttggtgtgcctgtacct
cgcggtatccctgcgttcacagtgcaagaggccgtcgaggccgcccagaagctcggcggc
cccgtgtgggtcgtgaaggcccagatccacgctggtggtcgcggcaagggcggcggcgtg
aaggttgccaagagcattgacgacgtcaaggcactggctggccagatcctgggcatgcag
ctggtcacgcaccagaccggccccgaaggccagaaggtccgccgcctgtacatcgaagac
ggcgccgacatccagaaggaatactacctgtcgtgcgtgaccgatcgcggcacgcagaag
gtggccttcatcgcttccagcgaaggcggcatggacatcgaggaagtggcccactccact
cccgagaagatcatcaccatcttcgttgaccccctggtcggcctgacccaggcccagggc
gaagaactggccaagggcatcggcatgcctgccgactccaccgcccagttcatcgacatc
tgccagaagctctacaagtgctacatggacacggatgcctcgctggtcgagatcaacccg
ctgaaccgtgacagcaagggcaacgtggttgccctggacgcgaagttcaacttcgacgcc
aacgccctgttccgcctgcccgaaatcgtggcactgcgcgacctggacgaagaagatccc
gctgaagtcgaagcctccaagttcgatctggcctacatctcgctggacggcaacatcggc
tgcctggtcaacggtgcaggtctggccatggccaccatggacaccatcaagctgttcggc
ggcgagccggccaacttcctggacgtgggcggcggtgccacccccgagaaggtcaccgaa
gccttcaagatcatgctcaagaaccccaaggtcgaaggcattctggtcaacatcttcggc
ggcatcatgaagtgcgacaccatcgccaccggcgtgatcactgcctgcaaggccgtgaac
ctgcaagtgcccctggtcgtgcgcatgaagggcacgaacgaagaactgggcaagaagatg
ctggccgagtccggcctgcccatcatcagcgccgacacgatggccgaagcggccaccaag
atcgtcgaagccgtcaagtaa

DBGET integrated database retrieval system