KEGG   Delftia acidovorans: Daci_0889Help
Entry
Daci_0889         CDS       T00620                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
dac  Delftia acidovorans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Daci_0889
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Daci_0889
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Daci_0889
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1000140..1000646
Genome map
AA seq 168 aa AA seqDB search
MNDTAAAPRSAYDFEATSITGQAVPLSDYRGKVLLIVNTASACGFTPQYAGLQALHEQYG
ERGLVMLGFPCNQFGSQEKGSESEIASFCDLNFGVRFPLMGKIDVNGANAHPLYRWLTAE
APGVLGTKAIKWNFTKFLVGRDGQVIRRYAPQDAPAKLSTDIEAALAL
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacaccgccgccgcgccccgctcggcctacgacttcgaggccacctccatcacg
ggccaggccgtccccctgtcggactaccgcggcaaggtgctgctcatcgtcaacaccgcc
agcgcctgcggcttcacgccgcagtacgccggcctgcaggcgctgcatgagcagtacggc
gagcgcggcctggtgatgctgggctttccgtgcaaccagttcggttctcaggaaaagggc
agcgaatcggaaatcgccagcttctgcgacctgaactttggcgtgcgctttccgctcatg
ggaaagatcgacgtcaacggcgccaacgcccacccgctgtaccgctggctcactgccgag
gcgccgggcgtgctcggcaccaaggccatcaagtggaacttcaccaaattcctcgttggc
cgcgacggccaggtcatccgccgctatgcgccgcaggatgcgccggccaagctgtccacg
gacatcgaggccgcgctggcgctttga

DBGET integrated database retrieval system