KEGG   Delftia acidovorans: Daci_1109Help
Entry
Daci_1109         CDS       T00620                                 

Definition
nitrate reductase subunit alpha
Orthology
K00370  
nitrate reductase alpha subunit [EC:1.7.99.4]
Organism
dac  Delftia acidovorans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Two-component system
Module
Dissimilatory nitrate reduction, nitrate => ammonia
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Daci_1109
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daci_1109
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.99  With other, unkown, acceptors
    1.7.99.4  nitrate reductase
     Daci_1109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1229737..1233576
Genome map
AA seq 1279 aa AA seqDB search
MSHFLDKLSYFSLPRQEFSNGHGQVTGEDRTWEDAYRDRWAHDKVVRSTHGVNCTGSCSW
KIYVKGGIVTWETQQTDYPRTRADLPNHEPRGCARGASYSWYLYSANRVKYPMVRGRLLK
HWRAALAVARSPVDAWAAIVENADARSEWQKQRGLGGFVRSSWDEVNRMIAAANVYTIKK
HGPDRIIGFSPIPAMSMISYAAGSRYLSLIGGVCMSFYDWYCDLPPASPQTWGEQTDVPE
SADWYNSNFIIAWGSNVPQTRTPDAHFFTEVRYKGAKVVAVTPDYSEVAKLADLWMHPKQ
GTDAAVAMAMGHVILKEFYFGERGRPAYFEDYARRYTDLPLLIRLKRQQLPDGRTVLVPE
RYVRASDFDGHLGQDSNPEWKTVAYGEDGGVALPNGSIGFRWGEAGRADEGLWNLESKEA
RTGNDVQLKLSVLDGQGVDSEVADVAFPYFGGLQSPGFDANEQGTDVLLRRVPVSRMVLD
GEEAIVATVFDLLAGNYGIHRGLEGEGADGGYDADAPYTPAWQEKITGVPRDQVIAIARQ
FADNAEKTRGKSMVIIGAAMNHWYHCDMNYRGIINMLMLCGCIGQSGGGWAHYVGQEKLR
PQTGWTALAFALDWLRPPRQMNSTSFFYAHTDQWRYEKLGVEEVLSPLADRSQYGGAMID
YNVRAERMGWLPSAPQLQANPLQLVRDAQAQGLDVKDHVVQSLQDGSLSMSCEDPDHPAN
WPRNMFVWRSNILGSSGKGHEYFLKHLLGTTHGVQGKDLGEQDPPDALRASSQGAAGLGR
PGAGHSAKPQEVRWHDKAPEGKLDLLVTLDFRMSTTCLYSDIVLPTATWYEKNDLNTSDM
HPFIHPLSAAVDPAWQARSDWEIYKGFAKSFSEVCVGHLGVEKDVVLTPLMHDTPAELAQ
PDGVRDWKKGECALIPGKTAPQIAVVERDYPNLYKRFTALGPLMDRLGNGGKGIGWNTET
EVEQLGELNGLVREEGVSQGRPRIVTDIDATEVVMMLAPETNGHVAVKAWEALSKQTGRE
HAHLALHREDEKIRFRDIQAQPRKIISSPTWSGLESEKVSYNACYTNVHELIPWRTLTGR
QQFYQDHPWMRDFGEGFVSYRPPVHMKALQEVQGQKPNGHPEIALNFITPHQKWGIHSTY
GDNLMMLTLARGGPIVWLSEDDAKSAGIADNDWVELYNANGAIAARAVVSQRVKPGMVMM
YHAQEKTINTPGSEITGTRGGIHNSVTRIVLKPTHMIGGYAQYSYGFNYYGTIGTNRDEF
VLVRKMRRIDWLDEEVNTP
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atgagccattttctggacaagctttcctacttctccctgccccggcaggaattctccaac
ggccatggccaggtgacgggcgaggaccgcacctgggaagacgcctaccgcgaccgctgg
gcgcatgacaaggtggtgcgctccacgcacggcgtgaactgcacgggctcgtgctcgtgg
aagatctacgtcaagggcggcatcgtgacctgggagacccagcagaccgactacccgcgc
acgcgcgccgacctgcccaaccacgagccgcgcggctgcgcgcgcggcgccagctacagc
tggtatctgtacagcgccaaccgcgtcaaataccccatggtgcgcggccggctgctcaag
cactggcgcgccgccctggccgtggccaggagcccggtcgatgcctgggccgccatcgtc
gagaacgcggatgcgcgcagcgagtggcagaagcagcgcggcctgggcggcttcgtgcgc
agcagctgggacgaggtcaaccgcatgatcgcggcggccaacgtctacaccatcaagaag
cacgggccggaccgcatcatcggcttctcgccgattccggccatgtccatgatctcgtat
gccgcaggcagccgctacctgagcctgatcggcggcgtgtgcatgagcttctacgactgg
tactgcgacctgccgccggccagcccccagacctggggcgagcagaccgacgtgccagag
agcgcggactggtacaactccaacttcatcatcgcctggggctccaacgtgccccagacg
cgcacccccgatgcccacttcttcaccgaggtccgctacaagggcgccaaggtcgtggcc
gtcacgcccgactactccgaggtcgccaagctggccgacctgtggatgcaccccaagcag
ggcacggatgccgccgtggccatggccatgggccacgtcatcctcaaggagttctacttc
ggcgagcgcggccgcccggcctatttcgaggactatgcgcgccgctacaccgacctgccg
ctgctgattcgcctcaagcgccagcaactgcccgatggccgcacggtcctggtgcccgag
cgctatgtgcgcgccagcgacttcgacggccacctgggccaggacagcaatcccgaatgg
aagaccgtggcctacggcgaggacggcggcgtggccctgcccaacggctccatcggcttt
cgctggggcgaggccggccgcgccgacgagggcctgtggaacctcgaatccaaggaggcg
cgcacgggcaatgacgtgcagctcaagctctcggtgctggacggccagggcgtggacagt
gaagtggccgacgtggccttcccctacttcggcggcctgcagtcgccgggcttcgacgcc
aacgagcagggcacggatgtgctgctgcgccgcgtgcctgtctcgcgcatggtgctggac
ggcgaggaggccatcgtggccaccgtgttcgacctgctggcgggcaactacggcatccac
cgcggcctggaaggcgagggcgctgatggcggctatgacgccgatgcgccctacaccccg
gcctggcaggaaaagatcaccggcgtgccgcgtgaccaggtgatcgccattgcgcgccag
ttcgccgacaacgccgagaagacgcgcggcaagtccatggtcatcatcggcgcggccatg
aaccactggtaccactgcgacatgaactaccgcggcatcatcaacatgctgatgctgtgc
ggctgcataggccagagcggcggcggctgggcgcactacgtgggccaggaaaagctgcgc
ccgcagaccggctggaccgcgctggcctttgcgctggactggctgcgcccgccgcgccag
atgaactccaccagcttcttctacgcccacaccgaccagtggcgctacgagaagctgggt
gtggaagaggtgctgtccccgctggccgaccgcagccagtacggcggcgccatgatcgac
tacaacgtgcgcgccgagcgcatgggctggctgcccagcgccccgcagctgcaggccaac
ccgctgcagctggtgcgcgacgcccaggcccagggcctggacgtgaaggaccacgtggtg
cagtccctgcaggacggctcgctgtccatgagctgcgaggaccccgaccacccggccaac
tggccgcgcaacatgttcgtgtggcgctccaacatcctgggcagctcgggcaagggccac
gagtacttcctcaagcacctgctgggcaccacccatggcgtgcaaggaaaagaccttgga
gaacaagacccccccgatgcgctgcgcgcctcctcccagggggcggccggcttggggcgg
cccggcgccggccattcggccaagccgcaggaagtgcgctggcacgacaaggcgcccgaa
ggcaagctggacctgctggtcacgctggacttccgcatgagcaccacctgcctgtactcg
gacatcgtcctgcccacggccacctggtatgagaagaacgacctcaacaccagcgacatg
caccccttcatccatccgctgtcggcggccgtggacccggcctggcaggccaggagcgac
tgggagatctacaagggcttcgccaagtccttcagcgaggtctgcgtgggccacctgggc
gtggaaaaggacgtggtgctcacgccgctgatgcacgacacccccgccgagctggcccag
cccgatggcgtgcgcgactggaagaagggcgagtgcgccctgatccccggcaagaccgcg
ccgcagattgccgtggtcgagcgcgactatcccaacctctacaagcgcttcacggccctg
ggcccgctgatggacaggctgggcaacggcggcaagggcatcggctggaacaccgagacc
gaggtggagcagctgggcgagctcaacggcctggtgcgcgaggaaggcgtgagccagggc
cgcccgcgcatcgtcaccgacatcgacgccaccgaggtggtgatgatgctggcgcccgag
accaacggccacgtggccgtcaaggcctgggaggcgctgtcgaagcagacggggcgcgag
cacgcccacctggccctgcaccgcgaggacgagaagatccgctttcgcgacatccaggcc
cagccgcgcaagatcatcagctcgcccacctggtcgggcctggaaagcgagaaggtcagc
tacaacgcctgctacaccaacgtgcatgagctgatcccatggcgcaccctcaccggccgc
cagcagttctaccaggaccatccgtggatgcgcgacttcggcgaaggcttcgtcagctac
cgcccgcccgtgcacatgaaggcgctgcaggaagtgcagggccaaaagcccaacggccac
cccgagatcgcgctgaacttcatcacgccgcaccagaagtggggcatccactccacctat
ggcgacaacctgatgatgctcacgctggcgcgtggcggccccatcgtctggctcagcgag
gacgacgccaagagcgccggcatcgccgacaacgactgggtggagctgtacaacgccaac
ggcgccatcgcggcgcgggccgtggtcagccagcgcgtcaagccgggcatggtgatgatg
taccacgcgcaggagaagaccatcaacacgccgggctcggagatcaccggcacgcgcggc
ggcatccacaactcggtcacgcgcatcgtgctcaagcccacccacatgatcggcggctac
gcgcagtacagctacggcttcaactactacggaaccatcggcaccaaccgtgacgaattt
gtcctggtgcgcaagatgcgccgcatagattggctggatgaagaggtgaacaccccctga

DBGET integrated database retrieval system