KEGG   Delftia acidovorans: Daci_1531Help
Entry
Daci_1531         CDS       T00620                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Daci_1531
Secretion system [BR:dac02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Daci_1531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1719439..1720257)
Genome map
AA seq 272 aa AA seqDB search
MRLVPLLRGAPRRAIPLNHGAAGLNAAPPTHRIAMKLFACLLTAASLTWSLGVHAQDANL
RKTLTERIPQLEKIDEIRPTPMSGLFEVRIGTDLFYTDAKGNYLIQGELIDTKARRNLTE
DRMNQLTAVDFKQLPLKDAVTIVHGKGERKMAVFEDPNCGYCKRFERDLQTVDNVTIYLF
LYPILSPDSAEKSRNIWCAKDQAGAWADHMLRDKVPAAAQCDTSAVQRNLAFGRKYKITG
TPTVIFTNNTRVPGAISAQEVEKNLAAAAAAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
ttgcgactcgtacccctgctccgtggcgccccgcgccgcgcaatccccctcaaccacggc
gcggccggcctgaacgcggccccgcccacccaccgcattgccatgaaactcttcgcctgc
ctgctgacggccgccagcctgacctggagcctcggtgtccatgcccaggacgccaacctg
cgcaagacgctgaccgagcgcattccccagctggaaaagatcgacgaaatccgtcccacg
cccatgtccggcctgttcgaagtgcgcatcggcacggacctgttctacacggacgccaag
ggcaactacctgatccagggcgagctgatcgacaccaaggcgcgccgcaatctcaccgaa
gaccgcatgaaccagctgacggcggtggacttcaagcagctgccgctcaaggacgccgtg
accatcgtccacggcaagggcgagcgcaagatggccgtgttcgaagatcccaactgcggc
tactgcaagcgtttcgagcgcgacctgcagactgtggacaacgtcaccatctacctgttc
ctgtaccccatcctgagccccgactcggccgagaagtcgcgcaacatctggtgcgccaag
gaccaggccggtgcatgggccgaccacatgctgcgcgacaaggtgccggccgccgcccag
tgcgacacctcggccgtgcagcgcaacctggcctttggccgcaagtacaagatcacggga
acgcccaccgtcatcttcaccaacaacacccgagtgcctggcgccatcagcgcccaggaa
gtcgagaagaacctggccgcagccgcagccgcgcgctga

DBGET integrated database retrieval system