KEGG   Delftia acidovorans: Daci_1761Help
Entry
Daci_1761         CDS       T00620                                 

Definition
(GenBank) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dac  Delftia acidovorans
Pathway
dac00010  Glycolysis / Gluconeogenesis
dac00620  Pyruvate metabolism
dac00640  Propanoate metabolism
dac00680  Methane metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_1761
   00620 Pyruvate metabolism
    Daci_1761
   00640 Propanoate metabolism
    Daci_1761
  Energy metabolism
   00680 Methane metabolism
    Daci_1761
Enzymes [BR:dac01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Daci_1761
Lipid biosynthesis proteins [BR:dac01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Daci_1761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABX34403
UniProt: A9BUU1
Position
complement(1958666..1960648)
Genome map
AA seq 660 aa AA seqDB search
MSQDLAPSLAPSYPPSAELARNARVSGRAAYDRLVAEADADPQAFWGRLAREFVAWKRPF
TRVLDESRAPFYEWFNDGTLNASWNCLERNIQRGLGERTALIFEADDGAVTQVTYAQLLV
RVNRLANALRSLGVGKGDRVVIYMAMSIDGVAAMQACARIGAIHCVVFGGFSATALRDRI
ADTGACAVITADQQVRGGRQLPLKSIVDEALAQPGCEQVRHVLVARRTGGAIAMHQPRDL
WLEEITAAQSDVCEPEWVQAEHPLFLLYTSGSTGTPKGVQHATGGYLLHAAVTCAWTFDL
QPCDVFWCTADIGWVTGHTYIAYGPLALGATQVVFEGVPTYPDAGRFWKMIEAHGVTVFY
TAPTAIRSLIKAADADAQVHPARYDLGSLRILGSVGEPINPAAWHWYHEQVGGGRCPIVD
TFWQTETGGHMITPLPGATDLVPGSCTLAFPGIAAAVVDEAGNELPWGDSGILVIKRPWP
SMIRNIWGHPERFVASYFPEEFKGRYYLAGDGAVRDARTGYFTITGRIDDVLNVSGHRMG
TMEIESALVAMTDLVAEAAVVGRPDDTTGEAICAFVVLKRSRPSGAEAADIARLLREWVA
KEIGPIAKPRDIRFGDNLPKTRSGKIMRRLLRSIARGEPIVQDTSTLENPAILEQLSQAC
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagaccttgcaccgtcccttgcaccgtcctatcccccatctgcagagctggcc
cgcaatgcgcgcgtgagcgggcgcgccgcctatgaccggctcgtcgcggaggcggacgcc
gatccccaggcgttctggggccggctcgcacgcgagttcgtcgcgtggaagcgcccgttc
acgcgagtgctcgatgaaagccgcgccccgttctacgaatggttcaatgacggcacgctc
aacgccagctggaactgcctggagcgcaacatccagcgggggctgggcgagcgcacggcc
ctcatcttcgaagccgatgacggcgcggtgacgcaggtgacctatgcgcagcttcttgtc
cgggtcaatcgcctggccaacgccctgcgcagcctgggtgtcggcaagggcgaccgcgtc
gtcatctacatggccatgtcgattgacggcgtggccgccatgcaggcctgtgcacgcata
ggcgccattcactgcgtggtgttcggcggcttctccgccacggcgctgcgcgaccgcatt
gcggacacgggggcctgcgccgtcatcacggcagaccagcaagtgcggggaggacggcaa
ttgcccctcaagagcatcgtggacgaggccctggcccagcccggctgcgagcaggtccgc
cacgtgctggtggcacggcgcacgggcggcgccatcgccatgcaccagccccgggacctg
tggcttgaagaaatcactgcagcccagagcgatgtctgcgaaccggaatgggtgcaggcc
gagcatccgctgttcctgctctacacctcgggctccaccggaacccccaagggcgtccag
cacgccacgggaggctatctgctgcatgccgccgtgacctgcgcctggaccttcgacctg
cagccctgcgatgtcttctggtgtacggcggacatcggatgggtgaccggccatacctat
atcgcctacggcccgctggcgctgggcgccacgcaggtggtgttcgagggcgtgcccacc
tacccggacgcgggacgcttctggaaaatgatcgaggcccatggggtgacggtcttctac
acggcgcccacggccattcgctcgctgatcaaggccgccgacgccgatgcgcaggtgcat
cccgcgcgctacgacctgggcagcctgcgcatcctggggtccgtgggcgagccgatcaat
cccgccgcctggcactggtaccacgagcaggtgggcgggggccgctgccccatcgtcgat
acgttctggcagacggagacgggcgggcacatgatcacgccgctgcccggagccacggac
ctggtgcccggctcctgcacgctggccttcccgggcattgccgccgccgtggtggacgag
gccggcaacgagctgccctggggcgacagcggcatcctggtgatcaagcgcccctggccc
tccatgatcaggaacatctggggccatcccgagcggtttgtcgccagctactttcccgaa
gaattcaagggccgctactacctggcgggagacggcgcggtccgcgatgcgcgcaccggc
tacttcaccatcaccggccgcatcgacgatgtgctcaacgtcagcggccaccgcatgggc
acgatggagatcgagtccgccctggtggccatgaccgacctggtggcggaggccgccgtc
gtggggcggcccgatgacacaacaggagaggccatatgcgccttcgtcgtcctcaagcgt
tcgcggcccagcggcgccgaggcggcagacatcgcccggctgctgcgggagtgggtggcc
aaggagatcgggccgatcgccaagcccagggacatccggttcggagacaacctgcccaag
acccgcagcggcaagatcatgcggcgattgctgcgcagcattgcacgcggcgagcccatc
gtgcaggacacctccaccctggagaacccggcgatcctggagcagctgtcacaggcctgc
tga

DBGET integrated database retrieval system