KEGG   Delftia acidovorans: Daci_1813Help
Entry
Daci_1813         CDS       T00620                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daci_1813 (gpmA)
   01230 Biosynthesis of amino acids
    Daci_1813 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_1813 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Daci_1813 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daci_1813 (gpmA)
Enzymes [BR:dac01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Daci_1813 (gpmA)
Exosome [BR:dac04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Daci_1813 (gpmA)
  Exosomal proteins of melanoma cells
   Daci_1813 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2010531..2011274)
Genome map
AA seq 247 aa AA seqDB search
MYKLVLIRHGESTWNLENRFTGWTDVDLTATGVEQAKNAGRLLKAEGYDFDLAYTSVLKR
ATRTLWHTLDEMDRTWLPVQHSWRLNERHYGGLQGLNKADMAKQYGDAQVLVWRRSYDTP
PPALEPQDPRSERSDVRYAQLDPSQVPLTECLKDTVARVLPFWNESIAPAILSGKRVVVA
AHGNSIRALIKYLDGISDDAIVGVNVPNGIPLVYELDANLKPIRHYYLGDAEAAAKAAAA
VAAQGKA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgtgctgatccgccacggtgaatccacctggaacctcgaaaaccgcttc
accggctggaccgatgtggacctgaccgccaccggcgtcgaacaggccaagaacgccggc
cgcctgctcaaggccgaaggctatgacttcgacctggcctacaccagcgtgctcaagcgc
gccacgcgcacgctgtggcacacgctggacgaaatggaccgcacctggctgcccgtgcag
cacagctggcgcctgaacgagcgccactacggcggcctgcagggcctgaacaaggcggac
atggccaagcaatacggcgacgcccaggtgctggtgtggcgccgcagctacgacacgccc
ccgccggccctggagccgcaagacccgcgcagcgagcgcagcgacgtgcgctacgcccag
ctggaccccagccaggtgccgctgaccgaatgcctgaaggacacggtggcccgcgttctg
ccgttctggaacgagtccatcgcgcccgccatcctgtccggcaagcgcgtcgtggttgcg
gcccacggcaactccatccgcgcgctgatcaagtacctggacggcatctcggatgacgcc
atcgtcggcgtcaacgtgcccaatggcattccgctggtctatgagctggatgccaatctc
aagcccattcgccactattacctgggcgatgcagaagctgccgccaaggctgcagccgcc
gtggccgcacagggcaaggcctga

DBGET integrated database retrieval system