KEGG   Delftia acidovorans: Daci_2189Help
Entry
Daci_2189         CDS       T00620                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
dac  Delftia acidovorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daci_2189
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Daci_2189
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2402744..2403283
Genome map
AA seq 179 aa AA seqDB search
MAPWAGMTEPGHWVAIGLGANLGDRGQALAQALQAIGGLPGTRLVAVSSLYSTAPVDSSG
PDYLNAVAAVHTTLQPLALLDALQAIELAAGRERPYRNAPRTLDLDIELWDDERIALPRL
SVPHPRMHERAFVLVPLAEIAPERITPAQLQAVAGQGIVRSAGPGWHLRDGGALANGSR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgtgggcggggatgactgagccggggcactgggtcgccattggcctgggcgcc
aatctgggcgaccggggccaggcgctggcccaggcgctgcaggccattggcggcctgccg
ggcacgcgccttgtggccgtgtcctcgctctacagcacggcacccgtcgattccagcggt
ccggactatctgaacgccgtggccgccgtgcacaccacgctgcagccgctggccctgctc
gatgcgctgcaggccatcgaactggcggccggccgtgagcgtccctaccgcaacgcgccg
cgcacgctggacctggacatcgaactgtgggacgacgagcgcatcgcgctgccgcgcctg
agcgtgccgcacccgcgcatgcacgagcgcgccttcgtgctcgtgccgctggccgagatc
gcgcctgagcgcatcacacccgcgcagctgcaggccgtggcggggcagggcatcgtgcgc
agcgccgggcccggctggcatcttcgggatggcggggccctggcgaacggctcccgttaa

DBGET integrated database retrieval system