KEGG   Delftia acidovorans: Daci_2215Help
Entry
Daci_2215         CDS       T00620                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dac  Delftia acidovorans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Daci_2215
   00052 Galactose metabolism
    Daci_2215
   00500 Starch and sucrose metabolism
    Daci_2215
   00520 Amino sugar and nucleotide sugar metabolism
    Daci_2215
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Daci_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2427802..2428689)
Genome map
AA seq 295 aa AA seqDB search
MSNQTRVRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAYEAGIRDMIFVT
GRSKRAIEDHFDTAYELENELENAGKQAMLELVRSISPADMNCLFVRQPRSLGLGHAVLC
AEPLVGNEPFAVLLADDLMVGEPGGPGVMAQMTSAFHKQGRSLLAVQEVPLEQTKRYGIV
AGEPAGGSLMRIEKIVEKPAPEKAPSRMGVAGRYVLTPAIFEEIRNQPKGVGGEIQLTDA
IERLMAHEAVYAFQYQGKRYDCGSKEGFLQATVELALQHEDVGASFREYLQGLSI
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcagacccgtgtccgcaaagccgtgtttcccgttgccgggctcggcacgcgc
tttctgcccgccaccaaggcctctcccaaggagatgctgcccgtggtggacaagccgctg
atccagtacgccgtggaagaggcctacgaggccggcatccgcgacatgatcttcgtcacc
ggccgcagcaagcgcgccatcgaggaccatttcgacaccgcctacgagctggaaaacgaa
ctggagaacgccggcaagcaggccatgctggagctggtgcgcagcatcagcccggccgac
atgaactgcctgttcgtgcgccagccgcgctcgctgggcctgggccatgccgtgctgtgc
gccgagccgctggtgggcaacgagccctttgccgtgctgctggccgacgacctgatggtg
ggcgagcctggcggccccggcgtgatggcgcagatgacatcggccttccacaagcagggc
cgctccctgctggccgtgcaggaagtgccgctggagcagaccaagcgctacggcatcgtg
gctggcgagccggccggcggttcgctgatgcgcatcgagaagatcgtggaaaagcccgcg
cccgagaaggccccctcgcgcatgggcgtggctggccgctacgtgctgacaccggccatc
ttcgaggagatccgcaaccagcccaagggcgtgggcggcgagatccagctgacggacgcc
atcgaacgcctgatggcccatgaagccgtctacgccttccagtaccagggcaagcgctac
gactgcggcagcaaggaaggctttttgcaggccacggtggaactggcgctgcagcacgag
gatgtgggcgcgagcttccgcgaatacctgcagggcctgagcatctga

  All links  
No link information was found.   
DBGET integrated database retrieval system