KEGG   Delftia acidovorans: Daci_2747Help
Entry
Daci_2747         CDS       T00620                                 

Definition
acetate--CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:dac01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dac00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:dac00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dac00640]
Metabolism; Energy metabolism; Methane metabolism [PATH:dac00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3017570..3019570
Genome map
AA seq 666 aa AA seqDB search
MSTATASPIESVLVENRVFPPPADFAAKARISGMEQYKALCAEAENDYQGFWARLARENV
VWSKPFTQVLDDSNPPFFRWFADGELNASANCLDKHMGTDVEHKTAIIFEADGGEVTKVS
YRELLERVSQFANALKAQGVQKGDRVLIYMPMTIEGVVAMQACARIGATHSVVFGGFSAK
AVQERIVDVGAVAVITANYQMRGGKELPLKAIVDDALALGGCEAVRHVFVYERTATACAM
TAGRDKTFGEILAGQSTECAPVAVDSEHPLFILYTSGSTGKPKGVQHCTGGYVLWARQTM
EWTFDLKPSDVFWCTADIGWITGHTYVAYGPLAAGATQIVFEGVPTFPNAGRFWQMIERH
GCTIFYTAPTAIRSLIKAADGDAAVHPKNSDLSSLRLLGSVGEPINPEAWMWYHRNVGGE
RCPIVDTFWQTENGGHVIAPMPGATPLVPGSCTLPLPGIMAAIVDETGHELPNGAGGLLV
VTKPWPSMIRTIWGDPERFKKSYFPAELGGQTYLAGDGAVRSEDRGYFRITGRIDDVLNV
SGHRMGTMEIESALVSKTDLVAEAAVVGRPDDMTGEAICAFVVLKRSRPTGEEAKQIAKE
LRDWVAKEIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSIAKGEAITQDTSTLENPAILD
QLAETN
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgcaacagcatcccccattgaatcggtactggtggagaaccgggtcttcccg
ccgccggcagacttcgccgccaaggcccgcatctccggaatggagcagtacaaggcgctg
tgcgccgaggcagagaacgactaccagggcttctgggcccgcctggcgcgcgagaacgtg
gtctggtccaagcccttcacccaggtgctggacgacagcaacccgccgttcttccgctgg
ttcgccgacggcgaactcaatgccagcgccaattgcctggacaagcacatgggcacggac
gtcgagcacaagacggccatcatcttcgaggccgatggcggcgaggtcaccaaggtcagc
taccgcgaactgctggagcgcgtctcgcagttcgccaacgcgctcaaggcgcagggcgtg
caaaagggtgatcgcgtcctgatctacatgcccatgaccatcgagggcgtggtggccatg
caggcctgcgcgcgcatcggcgccacgcacagcgtggtgttcggcggcttctcggccaag
gcggtccaggagcggatcgtggacgtgggcgccgtggccgtgatcaccgccaactaccag
atgcgcggcggcaaggagctgccgctcaaggccatcgtggacgatgcgctggcgctgggc
ggctgcgaggccgtgcgccatgtcttcgtctacgagcgcacggccaccgcctgcgccatg
acggcaggccgcgacaagaccttcggcgagatcctggccggccagagcacggagtgcgcg
cccgtggccgtggattccgaacacccgctgttcatcctctacaccagcggctccacgggc
aagcccaagggcgtgcagcactgcacgggcggctatgtgctgtgggccaggcagaccatg
gagtggaccttcgacctcaagcccagcgacgtgttctggtgcacggccgacatcggctgg
atcacgggccacacctacgtggcctatggtccgctggccgctggcgccacgcagatcgtg
ttcgagggcgtgcccaccttccccaacgcgggccgcttctggcagatgatcgagcgccac
ggctgcaccatcttctacacggcgcccacggccatccgctcgctgatcaaggctgccgac
ggcgatgccgccgtgcatccgaagaactcggacctgtccagcctgcgcctgctgggcagt
gtgggcgagcccatcaatcccgaggcctggatgtggtaccaccgcaatgtgggcggcgag
cgctgccccatcgtggacaccttctggcagaccgagaacgggggccacgtgatcgccccc
atgcctggcgccacgccgctggtgccgggctcgtgcacgctgccgctgccgggcatcatg
gccgccatcgtcgacgagaccggccatgaactgcccaacggcgcaggcggcctgctggtg
gtcaccaagccctggcccagcatgatccgcaccatctggggcgaccccgagcgcttcaag
aagagctacttcccggccgagctgggcgggcagacctacctggccggcgacggcgcggtg
cgcagcgaggaccgtggctacttccgcatcacgggccgcatcgacgatgtgctcaatgtc
tcgggccaccgcatgggcacgatggagatcgagtcggccctggtgtccaagaccgacctg
gtggccgaggccgccgtggtgggccgccccgatgacatgacaggcgaggccatctgcgcc
ttcgtggtgctcaagcgctcgcgtcccacgggcgaggaggccaagcagatcgccaaggag
ctgcgcgactgggtggccaaggaaatcggccccatcgccaagcccaaggacatccgcttt
ggcgacaacctgcccaagacgcgcagcggcaagatcatgcgccgcctgctgcgctcgatt
gccaagggcgaggccatcacccaggacacgagcacgctggagaacccggccatcctcgac
cagttggccgagacgaactga

DBGET integrated database retrieval system