KEGG   Delftia acidovorans: Daci_2868Help
Entry
Daci_2868         CDS       T00620                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Daci_2868
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_2868
  Lipid metabolism
   00071 Fatty acid degradation
    Daci_2868
  Amino acid metabolism
   00350 Tyrosine metabolism
    Daci_2868
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Daci_2868
   00626 Naphthalene degradation
    Daci_2868
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Daci_2868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3145685..3146713
Genome map
AA seq 342 aa AA seqDB search
MNRTMKAAVVREFGKPLTIEEVPVPRPDPGHVLVKIEACGVCHTDLHAAQGDWPVKPNPP
FIPGHEGVGYVAAVGAGVTHVKEGDRVGIPWLYTACGHCEHCLGGWETLCEQQKNTGYSV
NGGFAQYALADANFVGLLPGSVDLIEIAPVLCAGVTVYKGLKVTDTKPGNWVVISGIGGL
GHMAVQYAKAMGLNVAAVDVDDDKLALARRLGAQVTVNAMTTDPAAYLKKEIGGAHGALV
TAVSPKAFEQALGMVRRGGTVSLNGLPPGSFPLPIFNMVLSGVTVRGSIVGTRLDLQESL
DFAAMGKVKATVSTDRLENINDIFARMHEGKIEGRVVLDLNA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaacaggaccatgaaggccgccgtggtgcgggagtttggcaagccgctcaccatcgag
gaagtcccggtgcccaggcccgatcccggccatgtgctggtgaagatcgaggcctgcggc
gtctgccataccgacctgcatgcggcgcagggcgactggcccgtcaagcccaatccgcct
ttcatcccaggccatgaaggcgtgggctatgtggccgccgtgggcgcgggcgtcacccat
gtgaaggagggcgaccgcgtcggcattccctggctgtacacggcctgcggccattgcgag
cattgcctgggcggctgggagacgctgtgcgagcagcaaaagaacaccggctactccgtc
aacggcggctttgcgcagtacgcgctggccgatgccaacttcgtgggcctgctgcccggc
agcgtggacctgatcgagatcgcacccgtgctgtgcgcgggcgtcaccgtctacaagggc
ctgaaggtcacggacaccaagcccggcaactgggtggtgatctcgggcatcggcggcctg
ggccacatggccgtgcagtacgccaaggccatgggcctgaacgtggcggcggtggatgtg
gatgacgacaagctggcgctggccaggcgcctgggcgcccaggtcacggtcaatgccatg
accacggaccctgcggcctacctgaaaaaggagatcggcggcgcacacggcgccctggtg
acggcggtatcgcccaaggccttcgagcaggcgctgggcatggtgcggcgcggcggcacg
gtgtcgctcaacggcctgccgccaggcagctttccgctgcccatcttcaacatggtgctc
agcggcgtgacggtgcgcggctccatcgtgggcacgcggctggacctgcaggagtcgctg
gacttcgcggccatgggcaaggtcaaggccaccgtgtccacagaccggctggagaacatc
aacgacatctttgcgcgcatgcacgaaggcaagatcgaagggcgcgtggtgctggacctg
aacgcctga

DBGET integrated database retrieval system