KEGG   Delftia acidovorans: Daci_3470Help
Entry
Daci_3470         CDS       T00620                                 

Definition
3-phosphoshikimate 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dac  Delftia acidovorans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dac00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:dac00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3801293..3802690
Genome map
AA seq 465 aa AA seqDB search
MKQWACAAAARPAGSPATLESRVVLSLLALHPMSNLIVHGGTPLRGRVVPSANKNAVLPI
LCATLLTDQPLRLHGVPDITDVRKILDIFRTLGSEVQLDEATRTLQLHHRDTRFDASSHR
LPEEMRSSIMLVPPLLARFGVARLEDNVKGCTLGVREIDPHVDIFRSFGGEVERASGSLL
IHSAAPLKAVRHWLDYASVTATENFVLCAVAAQGESMLTNAACEPHVQEFCRFMVMMGAD
IDGIGTSRLTVRGGAPLGGGDFTFEEDFHEITTFLALGAITGGDVEVRNSTPDNFPLIDR
TFAKFGVQVEHKNGWSRALRSGPLKVQTPFTSNVLTKVEAAPWPYFPVDLLPIFIALGVH
AQGNALFWNKIYDGALGWTGELSKFGAHVFSSDPHRVVTFGGNPLTPAVVESPYIIRVAI
ALFMVASSIEGRSEIRNATPIRRAHPHFVENLRSLGARVEWTNEE
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagtgggcgtgcgctgccgctgcaaggcctgcgggcagcccggcaaccctagaa
tcacgcgttgtcctatcgctgctagcgctgcaccccatgtccaatctcatcgtccacggc
ggcacgcctttgcgcggccgcgtcgttccctccgccaacaagaatgccgtgctgccgatt
ctgtgcgccacgctgctgaccgatcagccgctgcggctgcatggcgtgccggacatcacg
gatgtgcgcaagatcctcgacatctttcgcacgctgggcagcgaggtgcaactggacgag
gccacgcgcacgctgcagctgcaccaccgcgacacgcgcttcgacgcgtcctcgcaccgc
ctgcccgaggaaatgcgctcttccatcatgctggtgccgccgctgctggcgcgctttggc
gtggcacggctggaggacaacgtcaagggctgcacgctgggcgtgcgcgagatcgatccg
cacgtggacatctttcgctcctttggcggagaggtggagcgcgccagcggctccctgctg
atccacagtgccgcgccgctcaaggccgtgcgccactggctggactatgcatcggtcacg
gccacggagaacttcgtgctgtgcgccgtggctgcgcagggcgagtccatgctgaccaat
gcagcctgcgagccgcatgtgcaggagttctgccgcttcatggtgatgatgggtgcagat
attgacggcatcggcacctcgcggctgacggtgcgcggcggtgcgccgctgggcggcggc
gatttcaccttcgaggaagacttccacgagatcaccacctttctcgcgctgggtgcgatc
acgggcggcgatgtggaggtgcgcaacagcacgccggacaactttccgctgatcgaccgc
accttcgccaagtttggcgtgcaggtggagcacaagaacggctggtcgcgcgcgctgcgc
tcggggccgctgaaggtgcagacgcctttcaccagcaatgtgctcaccaaggtggaagcc
gctccctggccgtactttccggtggatctgctgccgatcttcattgcgctgggtgtgcat
gcgcagggcaatgcgctgttctggaacaagatctacgacggcgcgctgggctggacgggc
gagctatccaagttcggcgcccatgtgttttcttcggacccgcatcgcgtggtcaccttt
ggcggcaatccgctgacgccggccgtggtggagagcccctacatcatccgcgtggcgatt
gcgctgttcatggtcgccagcagcatcgagggtcgatcggagatccgcaacgccacgccg
attcgccgtgcgcatccgcactttgtcgagaacctgcgcagcctgggcgcgcgggtggag
tggaccaacgaggagtga

DBGET integrated database retrieval system