KEGG   Delftia acidovorans: Daci_3494Help
Entry
Daci_3494         CDS       T00620                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dac  Delftia acidovorans
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daci_3494
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Daci_3494
  Amino acid metabolism
   00310 Lysine degradation
    Daci_3494
Enzymes [BR:dac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Daci_3494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3834675..3835940
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESIAEATMLTWKKKAGEAVAIDEILIEIETDKVVLEVPAPAAGVLAEI
VQGDGATVVAEQLIAKIDTEGVAGVAAAAPAAAAAPAAAAPAAAPAAAAATGGSKGDVAM
PAAAKLLAENNLSAANVAGSGKDGRVTKGDALAAVKGGVQSTAAVIPTGVPTKALPQVSA
PAAKEDLSGRPEQRVPMSRLRARVAERLLQSQSTNAILTTFNEVNMAPVMDLRKKFQDAF
TKEHGTKLGFMSFFVKAAVHALKKYPVLNASVDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQMSFADIEKKIAEFGKKAAEGKLGIEEMTGGTFSISNGGTFGSMMSTPIINPPQSA
ILGVHATKDRAMVENGQVVVRPMNYLAMSYDHRIIDGREAVLGLVAMKDALEDPSRLLFD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgttgaagtcaaagttccccagctgtccgagtccatcgctgaggccaccatg
ctgacctggaagaagaaggccggcgaagcggttgcaatcgatgagatcctcatcgaaatc
gaaaccgacaaggtcgtgctcgaagtgcccgctcccgccgctggcgtgctggccgagatc
gtgcaaggtgatggcgccaccgtggtggccgagcagctgatcgccaagatcgacaccgaa
ggcgtggccggcgtggccgctgccgctcctgccgcagccgccgctcccgctgccgcagcg
cctgctgctgctcccgccgctgctgctgccactggcggcagcaagggcgatgtcgccatg
cccgccgctgccaagctgctggccgagaacaacctgtcggccgccaacgtggctggctcc
ggcaaggatggccgcgtgaccaagggcgacgccctggccgccgtcaagggcggcgtgcag
tccacggctgccgtcatccccaccggcgtgcccaccaaggcgctgccccaggtgtcggct
cccgctgccaaggaagacctcagcggccgtcccgagcagcgcgtgcccatgagccgcctg
cgtgcccgcgtggccgagcgcctgctgcagtcgcagtccaccaacgccatcctgaccacg
ttcaacgaagtgaacatggccccggtgatggatctgcgcaagaagttccaggacgccttc
accaaggaacacggcaccaagctgggcttcatgtccttcttcgtcaaggcggcagtgcac
gccctgaagaagtaccccgtgctcaatgcttccgtggacggcaacgacatcgtctaccac
ggctacttcgacatcggtatcgccgtgggttcgccccgtggcctggtggtgcccatcctg
cgcaatgcagaccagatgagcttcgccgacatcgaaaagaagattgccgaattcggcaag
aaggctgccgaaggcaagctgggcattgaagaaatgaccggcggcaccttctccatctcc
aacggcggcaccttcggctcgatgatgtccacccccatcatcaacccgccccagtcggcc
atcctgggcgtgcacgccaccaaggaccgcgccatggtcgagaacggccaggtcgtggtc
cgcccgatgaactatctggccatgtcctatgaccaccgcatcatcgacggccgcgaagcc
gtgctgggcctggtggccatgaaggacgcgctggaagatccttcgcgcctgctgttcgac
ctgtaa

DBGET integrated database retrieval system