KEGG   Delftia acidovorans: Daci_3522Help
Entry
Daci_3522         CDS       T00620                                 

Definition
phosphoribosylamine--glycine ligase (EC:6.3.4.13)
Orthology
K01945  
phosphoribosylamine--glycine ligase [EC:6.3.4.13]
Organism
dac  Delftia acidovorans
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Daci_3522
Enzymes [BR:dac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     Daci_3522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3868057..3869340
Genome map
AA seq 427 aa AA seqDB search
MKILVIGGGGREHALAWKLAESPKSTKVYVAPGNGGTGLAGGKVENLNITDPQALREWAQ
AEKVALTVVGPEAPLAAGVVDEFRAHGLRIFGPSKAAAQLESSKAFSKDFMARHGIPTAL
YETFTDPVAAHAYVDRLGAPIVVKADGLAAGKGVVVATTLQEAHDAVDFMLVDNKYGVAH
NDGGARVVIEEFLAGEEASFIVLCDGKNVLALATSQDHKRLKDGDQGPNTGGMGAYSPAP
VVTADVHARAMREIILPTIRGMEKDGIPYTGFLYAGLMIDASGHPKTLEFNCRMGDPETQ
PIMMRLKSDLVDVMLAATDAKLDQVELQWDRRTALGVVMAAAGYPEDPRKGDAISGLPQD
AADAMVFHAGTQLKDGVPVTSGGRVLCVTVLADSVKQAQQKVYDVARGIHFDGAQYRRDI
GFRAVKN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttgtgattggtggcggaggccgcgagcacgccctggcgtggaaactggct
gaatcgccgaaatcgaccaaggtctatgtggcccccggcaacggtggcacgggcctggcc
ggcggcaaggtggaaaacctcaacatcaccgacccgcaggcgctgcgcgagtgggcgcag
gccgagaaggtcgcgctgaccgtggtcggccccgaggctccgctggctgccggcgtggtc
gatgagttccgcgcccacggcctgcgcatcttcggcccctccaaggcggccgcccagttg
gaaagctccaaggccttctccaaggacttcatggcgcgccacggcatccccacggcgctc
tatgaaaccttcaccgacccggtggcggcccatgcctacgtggaccgcctgggtgcgccc
atcgtggtcaaggccgacggcctggccgcaggcaagggcgtggtcgttgcgacaacgctg
caggaagcccacgacgccgtggacttcatgctcgtggacaacaagtacggcgtggcccac
aacgacggcggcgcccgcgtggtgatcgaggaattcctcgccggcgaggaagccagcttc
atcgtgctgtgcgacggcaagaacgtcctggccctggcaaccagccaggaccacaagcgc
ctgaaggacggcgaccagggcccgaacacgggcggcatgggcgcctactcgcccgcgccc
gtggtcacggccgacgtgcatgcccgcgccatgcgcgagatcatcctgccgaccatccgc
ggcatggaaaaggacggcattccctacaccggcttcctctatgcgggcctgatgatcgac
gcgtccggccatcccaagacgctggagttcaactgccgcatgggcgaccccgagacccag
cccatcatgatgcgcctcaagagcgatctggtggacgtcatgctggcggccaccgatgcc
aagctcgaccaggtcgagctgcaatgggaccgccgcacggcgctgggcgtggtcatggcc
gcagcaggctaccccgaggacccgcgcaagggcgatgctatcagcgggctgccgcaggac
gccgccgacgccatggtcttccatgccggcacccagctcaaggacggcgtgcccgtcacc
agcggtggccgcgtgctgtgcgtcaccgtgctggccgacagcgtcaagcaggcccagcaa
aaggtctatgacgtggcgcgcggcatccatttcgatggtgcccagtaccgccgcgacatc
ggcttccgtgccgtgaagaactga

DBGET integrated database retrieval system