KEGG   Delftia acidovorans: Daci_3688Help
Entry
Daci_3688         CDS       T00620                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dac  Delftia acidovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daci_3688
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daci_3688
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daci_3688
Enzymes [BR:dac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daci_3688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4053311..4054513)
Genome map
AA seq 400 aa AA seqDB search
MTSAFAPMPNTEGYFGPYGGQLVPPHLKQAMDDINTAYAEITKRQDFQQELAQLFADYVG
RPSPIFHARRLSEQLGGAQIHLKREDLNHTGAHKINHCLGEALLAKFMGKKKVIAETGAG
QHGVALATACALVGIPCEIHMGQVDIEKEHPNVTKMRILGCKLVPVTRGAATLKEAVDSA
FEEYLTNPTDYIYAIGSVVGPHPFPMMVRDFQSIIGREAREQFQAKHGKLPDHVAACVGG
GSNAMGIFTAFLGDASVKLVGVEPSGEGTDKPGRHAATLSMGKPGEIHGMKCYVLENADG
TPAAVHSIASGLDYPGVGPQHSYLKDLGRVQYESVTDKECLDAFMQLSRVEGIIPALESA
HAVAWAMRVAPGLPKDQHILINLSGRGDKDADYVAKVLGL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgccttcgctcccatgcccaacaccgagggctacttcggcccctacggcggc
cagttggtcccgccccacctcaagcaggccatggacgacatcaacaccgcctacgccgaa
atcaccaaacgccaagacttccagcaggaactggcccagctcttcgccgactacgtgggc
cgccccagccccatcttccacgcgcggcgcctgtcggagcagctcggcggcgcacagatc
cacctcaagcgcgaagacctcaaccacaccggcgcccacaagatcaaccactgcctgggc
gaagccctgctggccaagttcatgggcaagaaaaaggtcatcgcagaaaccggcgccggc
cagcacggcgtggccctggccacggcctgcgcgctggtgggcattccctgcgagatccac
atgggccaggtggacatcgagaaggaacatcccaacgtcaccaagatgcgcatcctgggc
tgcaagctcgtgcccgtcacgcgcggcgcggccacgctcaaggaggcagtggacagcgca
ttcgaggaatacctcaccaaccccaccgactacatctacgccatcggctccgtggtcggc
ccccacccgttcccgatgatggtgcgtgacttccagagcatcatcggccgcgaggcgcgc
gagcaattccaggccaaacacggcaagctgcccgaccatgtggcagcctgcgtgggcggc
ggctccaacgccatgggcatcttcaccgccttcctgggcgatgcctcggtcaagctcgtc
ggcgtggagccctcgggcgaaggcacggacaagcccggccgccacgcagccaccctcagc
atgggcaagcccggtgaaatccacggcatgaagtgctacgtgctggaaaacgcggacggc
acgcccgctgccgtgcacagcattgcctcgggcctggactatccgggcgtgggcccgcag
cacagctacctcaaggatctgggccgcgtgcagtacgaatccgtcaccgacaaggaatgc
ctggacgccttcatgcagctgtcgcgcgtggaaggcatcatccccgcgctggaaagcgcc
cacgccgtggcctgggccatgcgcgtggcgcccggcctgcccaaggaccagcacatcctc
atcaacctctcgggccggggcgacaaggacgccgactacgtggccaaggtgctgggcctc
tga

DBGET integrated database retrieval system