KEGG   Delftia acidovorans: Daci_3829Help
Entry
Daci_3829         CDS       T00620                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dac  Delftia acidovorans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dac02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dac02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4217784..4218398)
Genome map
AA seq 204 aa AA seqDB search
MPATTNTPASDAATAYEAIVIGGSAGALDALSAVLPTLPASLRASVLVVLHLPRDRRSLL
GQLFGPRCALPVREVQDQQWLEPGCLYFAPADYHLLVDSGPRLALSLDAPWHFSRPSIDV
LFESAADCYGERLLAVLLSGANEDGAQGMASVHAAGGLAVVQSPDSAAMQTMPRAALARV
PQAQVLAPQGIAALIASLHGQGRL
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgaccacgaacacacccgcctccgacgccgccacagcctacgaggccatcgtg
atcggcggctcggccggcgcgcttgatgcgctgtccgcggtgctgcccacgctgcccgcc
agcctgcgcgcttcggtgctggtggtactgcacctgccgcgcgaccggcgcagcctgctg
ggccagcttttcgggccgcgctgcgccctgccggtgcgcgaggtgcaggaccagcaatgg
ctggagccgggctgcctgtactttgcgccggccgactaccacctgctggtggacagcggt
cccaggctggcgctgtcgctggatgcgccctggcatttttcgcggccctcgatcgatgtg
ctgttcgagtcggctgccgactgctatggcgagcgcctgctggccgtgcttctgtccggc
gccaacgaggatggcgcccagggcatggccagcgtgcacgcggccggcggcctggccgtg
gtgcagtcgccagacagtgccgcaatgcagaccatgccgcgggcggccctggcccgcgtg
ccacaggcccaggtgctggcgccgcagggcattgccgcgctcatcgcatcgctgcacggc
caggggaggctttga

DBGET integrated database retrieval system