KEGG   Delftia acidovorans: Daci_3956Help
Entry
Daci_3956         CDS       T00620                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dac  Delftia acidovorans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4357522..4358232
Genome map
AA seq 236 aa AA seqDB search
MSLPLNSLPEHHSAQAHARYNMIEQQIRPWNVLDEEVLALLGKVHRENFVPPEHAGLAFM
DLEIPLVAPAEEAAAKGWCMLAPRIESRMLQDLKIKPTDRVLEIGAGSGYMAALLAAQAK
EVVTLEIVPELAEMARENLLGAGITNAEVKLADGATAAAALGQFDAIVLSGSVAQVPQAL
LAQLNDGGRLAAIVGQLPMMRFTLVQKNGHQFETSQPWDVVTARLANFEEPSRFTF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccctgaacagcctgcccgaacaccacagcgcccaagcgcacgcgcgctac
aacatgatcgagcaacagatccgcccctggaacgtgcttgatgaagaagtgctggcactg
ctgggcaaggtgcaccgcgagaatttcgtgccgcccgagcatgccggcctggccttcatg
gacctggaaatccccctggtcgccccggccgaggaagccgccgccaagggctggtgcatg
ctggccccgcgcatcgagtcccgcatgctgcaggacctgaagatcaagcccaccgaccgc
gtgctggaaatcggcgccggctcgggctacatggccgccctgctggccgcccaggccaag
gaagtcgtgacactggagatcgtgcccgagctggccgagatggcccgcgagaacctgctg
ggcgccggcatcaccaatgccgaggtcaagctggccgatggcgccacggcagcggccgcc
ctgggccagttcgacgccatcgtgctcagcggctcggtcgcccaggtgccgcaggccctg
ctggcccagctcaacgacggcggccgcctggcagccatcgtcggccaactgcccatgatg
cgtttcacgctggtgcaaaagaacggccaccagttcgaaaccagccagccctgggacgtg
gtgaccgcacgcctggccaacttcgaagagccttcgcgcttcacgttctga

DBGET integrated database retrieval system