KEGG   Delftia acidovorans: Daci_3956Help
Entry
Daci_3956         CDS       T00620                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Daci_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_11 Methyltransf_23 Methyltransf_31 Methyltransf_12 MTS CMAS Methyltransf_18 Methyltransf_32 PrmA Methyltr_RsmB-F Methyltransf_3 DUF938 Met_10 MetW TPMT Ubie_methyltran DOT1
Motif
Other DBs
NCBI-ProteinID: ABX36587
UniProt: A9BWR0
Position
4357522..4358232
Genome map
AA seq 236 aa AA seqDB search
MSLPLNSLPEHHSAQAHARYNMIEQQIRPWNVLDEEVLALLGKVHRENFVPPEHAGLAFM
DLEIPLVAPAEEAAAKGWCMLAPRIESRMLQDLKIKPTDRVLEIGAGSGYMAALLAAQAK
EVVTLEIVPELAEMARENLLGAGITNAEVKLADGATAAAALGQFDAIVLSGSVAQVPQAL
LAQLNDGGRLAAIVGQLPMMRFTLVQKNGHQFETSQPWDVVTARLANFEEPSRFTF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccctgaacagcctgcccgaacaccacagcgcccaagcgcacgcgcgctac
aacatgatcgagcaacagatccgcccctggaacgtgcttgatgaagaagtgctggcactg
ctgggcaaggtgcaccgcgagaatttcgtgccgcccgagcatgccggcctggccttcatg
gacctggaaatccccctggtcgccccggccgaggaagccgccgccaagggctggtgcatg
ctggccccgcgcatcgagtcccgcatgctgcaggacctgaagatcaagcccaccgaccgc
gtgctggaaatcggcgccggctcgggctacatggccgccctgctggccgcccaggccaag
gaagtcgtgacactggagatcgtgcccgagctggccgagatggcccgcgagaacctgctg
ggcgccggcatcaccaatgccgaggtcaagctggccgatggcgccacggcagcggccgcc
ctgggccagttcgacgccatcgtgctcagcggctcggtcgcccaggtgccgcaggccctg
ctggcccagctcaacgacggcggccgcctggcagccatcgtcggccaactgcccatgatg
cgtttcacgctggtgcaaaagaacggccaccagttcgaaaccagccagccctgggacgtg
gtgaccgcacgcctggccaacttcgaagagccttcgcgcttcacgttctga

DBGET integrated database retrieval system