KEGG   Delftia acidovorans: Daci_3979Help
Entry
Daci_3979         CDS       T00620                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
dac  Delftia acidovorans
Pathway
dac00010  Glycolysis / Gluconeogenesis
dac00020  Citrate cycle (TCA cycle)
dac00620  Pyruvate metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01130  Biosynthesis of antibiotics
dac01200  Carbon metabolism
Module
dac_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_3979
   00020 Citrate cycle (TCA cycle)
    Daci_3979
   00620 Pyruvate metabolism
    Daci_3979
Enzymes [BR:dac01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Daci_3979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H NQRA RnfC_N Peptidase_M23 HlyD_D23 DEC-1_N DUF2254 FAP
Motif
Other DBs
NCBI-ProteinID: ABX36610
UniProt: A9BWT3
Position
complement(4380483..4382174)
Genome map
AA seq 563 aa AA seqDB search
MALVEIQVPDIGDFDEVAVIEVLVKAGDQIKAEQSLITVESDKASMEIPSSHAGVLKELR
VNMGDKVKQGSIIAVVESAEAAAPAPAAAAPAPAAAAPAPVAAPAPAAAPAAAPAASGAA
TQIDIKIPDIGDFKDVAVIEMLVKVGDTVTAEQSLFTVESDKASMEIPSPAAGTITALTL
KIGDTVNVGDVVGQMSVQGAAAPAAQAAAPAPAAAAPAPATAAPAAAAPVAAAAASAPAA
APAHNPTVAPTGKLPHASPSVRKFARELGVPLDEVKGSGNKGRITADDIQAFTKSVMAGT
VQTKAQAATAPKGGSGGGAGLDLLPWPKVDFAKFGPVERKDLSRIKKISGANLSRNWVMI
PHVTNNDEADITDLEAFRVSTNKENEKSGVKVTMLAFVIKAVVAALKKFPEFNASLDGDT
LVYKQYFHVGFAADTPNGLVVPVLRDADKKGILQISQEMGELAKKARDGKLGAADMQGGC
FSISSLGGIGGTNFTPIINAPEVAILGLSKGQMKPVWDGKQFVPRLTLPLSLSYDHRVID
GASAARFNAFLGQVLADYRRILL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggcattggtagaaattcaagtccccgatatcggtgatttcgacgaagttgctgtgatc
gaagtgctggtcaaggccggcgatcagatcaaggccgagcaatcgctgatcacggtggag
tccgacaaggcctccatggagatcccctccagccacgctggcgtgctcaaggagctgcgc
gtcaacatgggcgacaaggtcaagcagggcagcatcattgccgtggtcgagtcggcggaa
gccgctgccccggcacctgcagccgccgcaccggcccccgccgctgcagccccggccccg
gtggctgcgcctgcaccggccgctgctcctgctgccgcgcctgcggcctcgggcgccgcc
acgcagatcgacatcaagattcccgacattggcgacttcaaggacgtggccgtgatcgag
atgctggtcaaggtcggcgacaccgtgacggccgagcaatcgctgttcaccgtcgaatcc
gacaaggcctcgatggaaatcccgtcgccagcggccggcaccatcacggcgctgacgctc
aagatcggtgacacggtcaacgtgggcgacgtggtcggccagatgagcgtgcagggcgct
gccgcgcctgcagcccaggctgcggccccggcacctgctgctgcagcccctgcaccggca
actgctgccccggccgctgcagctccggtggctgccgctgcagcatcggctcccgccgct
gcgcctgcgcacaaccccaccgtggcacccacgggcaagctgccccatgcatcgccctcg
gtacgcaagttcgcccgcgagctgggtgtgccgctggacgaggtcaagggctcgggcaac
aagggccgcatcacggccgacgacatccaggctttcaccaagtccgtcatggcgggtacc
gtgcagaccaaggcccaggccgcgaccgctcccaagggtggctccggcggcggcgcaggt
ctggacctgctgccctggcccaaggtcgacttcgccaagttcggcccggtcgagcgcaag
gacctgtcgcgcatcaagaagatcagcggcgccaacctgtcgcgcaactgggtcatgatc
ccgcacgtcaccaacaatgacgaggccgacatcaccgacctggaagccttccgtgtctcc
accaacaaggagaacgagaagagcggcgtcaaggtgaccatgctggccttcgtgatcaag
gcggtggttgcggccctcaagaagttccccgagttcaatgcctcgctggacggcgacacc
ctggtctacaagcagtacttccacgtcggctttgcggccgacacgcccaacggcctggtg
gtccccgtgctgcgcgatgccgacaagaagggcatcctgcagatcagccaggaaatgggc
gaactggccaagaaggcccgcgacggcaagctcggcgctgccgacatgcagggcggctgc
ttctcgatctcgtcgctgggcggcatcggtggcacgaacttcactcccatcatcaacgct
cctgaagtggccatcctcggcctgtccaagggccagatgaagccggtgtgggatggcaag
caattcgtgccgcgcctgacgctgccgctgtcgctgtcctatgaccaccgtgtcatcgac
ggtgcctcggccgcgcgcttcaatgccttcctgggccaagtgctggcggactaccgccgc
atcctgctgtaa

DBGET integrated database retrieval system