KEGG   Delftia acidovorans: Daci_4204Help
Entry
Daci_4204         CDS       T00620                                 

Definition
type III restriction protein res subunit
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     Daci_4204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4602520..4605525)
Genome map
AA seq 1001 aa AA seqDB search
MKLHFEPNLDYQMQAIEAVCDLFRGQEVCRTEFTVTMKLPDDVQMSLGVAQSDLGVGNRL
TLLDDELLKNLADIQLRGGLPPSSSLTSGDFTVEMETGTGKTYVYLRSIFELNKRYGFTK
FVIVVPSVAIKEGVYKTLQITEEHFKGLYAGVPFDYFLYDSGKPGPVRNFATSSNIQIMV
VTVGAINKKDVNNLYKESEKTGGEKPIDLIKATRPIIIVDEPQSVDGGMEGRGKEALDAM
NPLCTLRYSATHVDKHHMVFRLDAVDAYERKLVKQIEVASATVEDAHNRPFVRLVKVENK
RGRISAKVELDKQTATGVQRAEVTVSDGDDLQQSADGRAIYADFRVGEINTAKGEAFMEL
RYPGGEVFLQPGQAHGDVDALAVQREMIRRTIKEHLDKEKHLRPLGIKVLSLFFIDAVDK
YRQYDADGQPVKGVYAQMFEEEYRRAAKLPAYQSLFAEIDLESAAEEVHNGYFSIDKKGG
WTDTAENNAGNRENAERAYNLIMKEKEKLLSFGTPLKFIFSHSALKEGWDNPNVFQICTL
RDIQTERERRQTIGRGLRLCVNQDGERVRGFEVNTLTVVATENYEQFAENLQKEIEKDTG
IRFGIVEQHQFAAIAVTGADGHAAPLGIEQSKALWEHLKAAGHIDAKGKVQDSLKTALKN
GTLELPDEFDAQKAQIAEVLRKVSGRLDIKNADERRQVPLRKGKDGKAVYLSDEFKALWD
RIKHQTTYRVQFDNAKLVTDCIAALQKAPVIAKARLQWRKADISIGKAGVAATEKAGAAT
VVLDEADIELPDLLTDLQDRTQLTRRTIVSILTGSGRLNDFKRNPQQFIELTAETINRCK
RLALVDGIKYQKLGDQHVYAQELFEKEELTGYLKNMLLDTQKSIYEHVVYDSTTERDFAD
GLEKNDAIKLYAKLPGWFKVPTPLGTYNPDWAVLVEEDGTQHLYFVVETKSSLFTDDMRD
KESAKIECGKAHFTALEGGENPARYVVARSVGDLLTEAAKG
NT seq 3006 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgcacttcgagcccaacctcgactaccagatgcaggccatcgaggctgtatgc
gatcttttccgtggtcaggaggtctgccgcaccgaattcacggtgaccatgaaattgccc
gatgacgtgcagatgtcactgggcgtggcgcagtccgaccttggcgttggcaaccgcttg
accctgctggacgatgaactgctcaagaacctcgcggacatccagttgcgcggtggcttg
ccgccttccagttcgctgacttcgggcgacttcactgtggaaatggagaccggcaccggc
aagacctatgtgtatctgcgctcgattttcgagctgaacaaacgctacggcttcaccaag
ttcgtgatcgtggtgccttcagtggcgatcaaggagggtgtttataaaaccctgcagatc
accgaggaacacttcaaggggctctacgcgggcgtacccttcgattacttcctatacgac
tccggtaagccggggccggtgcgcaatttcgccacgagctccaacatccagatcatggtg
gtgacggtgggcgccatcaacaagaaggatgtgaacaacctctacaaagagagcgagaaa
accggcggcgagaagcccatcgacctgatcaaggccacccggccgataatcatcgtggat
gagccgcaaagcgtggacggcggcatggaaggccgtggcaaggaagcactggacgccatg
aacccgctctgcacgctgcgctactccgctacccatgtggacaagcaccacatggtattt
cgcctcgatgccgtcgatgcctacgagcgcaaactggtcaagcagatcgaggtggcgtcg
gccacggtagaggacgcgcacaacaggccctttgtgcgcctggtgaaggtggaaaacaag
cgcggccgcatcagcgccaaggtcgagctagataaacagaccgccactggtgtgcagcgg
gctgaagtgacggtcagcgacggcgacgacctccagcagagcgccgatggccgcgcgatc
tatgccgattttcgcgtcggcgagatcaacacggccaagggcgaagcgttcatggagctg
cgctaccccggtggcgaggtgtttttgcaacctggccaagcccacggtgatgtggatgcg
cttgccgtgcaacgcgagatgatccgccgcacgatcaaggaacacctggacaaggagaag
cacctgcgcccgctgggcatcaaggtgttgagcctgttcttcatcgacgcggtggacaaa
tatcgtcagtacgatgcggacggccagccggtcaagggtgtgtatgcgcagatgttcgag
gaggaatatcgccgtgccgccaagttgccggcttaccagagtttgtttgccgagatcgac
ctggagtccgccgccgaagaagtgcacaacggttatttctccatcgacaagaaaggcggc
tggactgacaccgccgagaacaatgcgggtaaccgggagaatgccgaacgcgcctacaac
ctgatcatgaaggagaaggagaagctgctgtccttcggtacgccgctgaagttcatcttc
tcccactccgccctcaaggaaggctgggacaaccccaacgtgttccagatttgcaccttg
cgcgacatccagaccgagcgcgagcgccgccagaccattggccgtggcctgcgtctgtgc
gtcaaccaggatggcgagcgggtacgcggctttgaggtcaacaccctgaccgtggtggcc
acggaaaactacgaacagtttgccgaaaacctgcagaaggaaatcgagaaagacacaggc
atccgctttggcatcgtggagcagcaccaatttgccgccattgccgtgactggcgctgat
gggcacgccgcaccgctgggcatcgagcaatcaaaggcactgtgggagcacctgaaagcc
gccggccatatagatgccaaaggcaaggtgcaggattcactgaaaacggcgctgaagaac
ggcaccttggaactgccggacgagtttgatgcgcaaaaggcccagattgctgaagtgctg
cgcaaggtgtcgggccggctcgatatcaaaaatgccgatgaacgcaggcaagtgccgctg
cgcaagggcaaggatggcaaggccgtttatctgagtgacgagttcaaggcactgtgggac
cgcatcaagcaccaaacaacgtaccgcgtgcagttcgataacgccaagttggtgacggat
tgcatcgcagcgttgcagaaggccccggtgattgccaaagcacgactgcaatggcgcaag
gccgacatctctatcggcaaggcgggtgtcgccgcgacggagaaagcgggcgcggcgacc
gtggtgctggacgaggcggatattgagctgccggatttgctgaccgaccttcaggatcgc
acccagctcacccggcgcaccatcgtcagcatcctgacgggaagcggtcgcctgaacgac
ttcaaacgcaatccgcagcagttcatcgaattgactgccgaaaccatcaaccgctgcaag
cgcttggccctggtcgatggcatcaagtaccagaagctgggtgaccagcatgtctatgcg
caggagctgttcgagaaggaagagctcaccggctatctcaagaacatgctgctggatacc
cagaagtcgatctacgagcacgtggtgtacgactcgaccactgagcgggatttcgccgat
gggctggagaagaacgacgccatcaagctctacgccaagttgccaggctggttcaaagtg
cccacgccgctgggcacctacaaccccgactgggccgtgttggtggaagaagacggcact
cagcacctgtattttgtggtggaaaccaagagcagcctgttcaccgacgatatgcgcgac
aaggaaagcgccaagatcgaatgcggcaaggcgcatttcactgcgctggagggcggcgag
aacccagcccggtatgtggttgcgcgctcggttggtgatcttttgaccgaggcggcaaag
gggtag

DBGET integrated database retrieval system