KEGG   Delftia acidovorans: Daci_4617Help
Entry
Daci_4617         CDS       T00620                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
dac  Delftia acidovorans
Pathway
dac00630  Glyoxylate and dicarboxylate metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01120  Microbial metabolism in diverse environments
dac01200  Carbon metabolism
Module
dac_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Daci_4617
Enzymes [BR:dac01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Daci_4617
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABX37246
UniProt: A9C3D5
Position
complement(5078098..5079513)
Genome map
AA seq 471 aa AA seqDB search
MRSSIRLKFDPKADARKPLVSTTSQESNMPQSLTQQLSREQQISALEKDWAQNPRWKGVK
RGYSAADVVRLRGSLQPEYTLAQRGAELLWDRINGGAKKGYVNAFGAISAGQAMQQAKAG
LEAVYLSGWQVAADGNTSETMYPDQSLYAYDSVPTMVRRINNTFKRADEIQWGRGINPGD
KEFIDYFLPIVADAEAGFGGVLNAFELMKNMIAAGAAGVHFEDQLAAVKKCGHMGGKVLV
PTQEAVEKLISARFAADVMGVPTIVLARTDAEAANLITSDHDANDKPFLTGERTQEGFYR
VRNGMEQSISRGVAYAPYADLVWCETGVPDIGFAREFAQAVHAACPGKLLSYNCSPSFNW
KKNLNDSQIASFQEDLSALGYKFQFITLAGIHINWFNTFKFAHAYANGEGMKHYVNMVQE
PEFAAREQGYTFVSHQQEVGAGYFDDVTTVIQGGSSSVKALTGSTEEEQFH
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcttctataagacttaaatttgatcccaaggccgacgcaagaaagccgcttgtt
tcaaccacctcccaggagagcaacatgccccaatccctgacccagcaactgagccgtgaa
cagcagatttccgcccttgagaaagactgggcgcaaaacccccgttggaagggcgtcaag
cgcggctacagcgccgccgacgtggtgcgcctgcgcggcagcctgcagcccgagtacacg
ctggcccagcgtggcgcggaactgctctgggacaggatcaacggcggtgccaagaagggc
tacgtgaatgcctttggcgccatctccgcaggccaggccatgcaacaggccaaggctggc
ctggaagcggtgtacctgtcgggctggcaggtggctgccgacggcaacaccagcgaaacc
atgtaccccgaccagtcgctgtacgcctatgactcggtgcccaccatggtgcgccgcatc
aacaacaccttcaagcgtgccgacgaaatccagtggggccggggcatcaaccccggcgac
aaggaattcatcgactacttcctgcctatcgtcgccgatgcggaagccggttttggcggc
gtgctcaacgcttttgaactgatgaagaacatgattgccgctggcgcagccggcgtgcac
ttcgaggaccaactggctgccgtgaagaagtgcggccacatgggcggcaaggttctggtg
cccacccaggaagccgtcgagaagctgatctccgcccgctttgccgctgacgtgatgggc
gtgcctaccatcgtgctggcccgcaccgatgctgaagccgccaacctgatcacctccgat
cacgacgccaacgacaagccgttcctgaccggcgagcgcacgcaggaaggcttctaccgt
gtccgcaatggcatggagcagtccatcagccgcggtgtggcctatgcgccctatgccgac
ctggtgtggtgcgaaaccggcgtgcccgacatcggctttgcccgcgagttcgcccaggcc
gtgcatgccgcctgcccaggcaagctgctgagctacaactgctcgccttcgttcaactgg
aagaagaacctcaacgacagccagatcgcctccttccaggaagacctgtctgctctgggc
tacaagttccagttcatcacgctggccggcattcacatcaactggttcaacacgttcaag
tttgcccacgcctacgccaacggcgaaggcatgaagcactacgtgaacatggtgcaggag
cccgaattcgcagcccgcgaacaaggctacaccttcgtgtcgcaccagcaggaagtgggt
gcaggctacttcgacgacgtgaccacggtgatccagggcggctcgtccagcgtcaaggca
ctgaccggctccacggaagaggagcaattccactga

DBGET integrated database retrieval system