KEGG   Delftia acidovorans: Daci_4670Help
Entry
Daci_4670         CDS       T00620                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Daci_4670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5124996..5125607)
Genome map
AA seq 203 aa AA seqDB search
MNEALRNRLLAAAAGLAVTAAGGYVATKEAGPSAAVTLAREIGLYYESSGRHIGTPYIDR
LGKGQPLTVCAGVTGPEVVAERYYTTEDCERLERPKYREAERLARRALRHWDAYNVWVQA
SFIDMAYNVPSALSPDTTVMRLANAGQLNAACEQMPRWVYGTVNGVPTRLPGLVDRRDAT
RELCAQWGRDGHFSAGLLARASQ
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaagccctgcgcaatcgcctcttggctgcagccgccggcttggcggtcactgcg
gccggtggctacgttgccacgaaagaggccgggccaagcgcggccgtgacgctggcccgt
gagatcgggctgtactacgaaagcagcggacggcacatcggcacgccctacatcgaccgc
ctgggcaaggggcagccgctgaccgtctgcgcgggcgtcacaggccccgaagttgtggcg
gagcgctactacacgaccgaggactgcgagcgcctggagcgtcccaaataccgcgaggcc
gagcgcttggcgcggcgcgccctgcggcactgggacgcctacaacgtgtgggtgcaggcc
agctttatcgacatggcctacaacgtgccctcggcgctgtcacctgacaccacggtcatg
cggctggccaacgccgggcagctcaatgcggcatgcgagcagatgccgcgatgggtctat
gggacggtcaacggcgttccaacacggctgcctggtcttgttgatcgccgcgatgccacg
cgcgagctgtgcgcgcagtggggtagggatgggcatttcagtgctggcctgttggcgagg
gcttcgcaatga

DBGET integrated database retrieval system