KEGG   Delftia acidovorans: Daci_5031Help
Entry
Daci_5031         CDS       T00620                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
dac  Delftia acidovorans
Brite
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Daci_5031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5568411..5570009
Genome map
AA seq 532 aa AA seqDB search
MAERSASELARETLRQLALNRLPPTPENYTRLYEQAAGEPGPASFPQGPLRHVHALLPAQ
TPGQKRLRDQLGAAIERSDWQGLQQVITAYANAALQPPAYEARPVELPVPPPVQALPDDL
TQQLARRFEALSTLLDTQDTKTGQLHQQLMEQLQSPPVDAKALARRLHDQHYQLSFAIAD
QLQVLQLMQELLQTLVQHLAQDPTHGSWLVQQLTAIEQAITPPLSPAPLADARRELQTVI
HRRLQLQDGMAAAQQALRDMLGGFVQHLAQITSSNETLGARMEEAARQLDGIQRLEDAAP
LLQQVLEATRTMAAGSRVAQEELQALRAHVDACEARIETLQQELDEAARRARHDPLTGQL
NRLGVSEALDREVARAQRHGQPLSVALVDMDGMQALNAELGHAMGDAALVHVAQLARQGL
RPEDVVGRYEGQAFVLLLPQTPETAGAQALQRLLQLLEQAPLPASAQTPGQPAPRPLSFS
AGVAQLQGHENGMDVLRRADTAMLQAKERGKHCIATASGAQSQPVGNAGAGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccgcttccgaactggcacgcgaaaccctgcggcaactggcgctgaac
cgcctgccgcccacaccggaaaactacacccgcctttatgaacaggcggctggcgagccc
ggccccgccagctttccccagggcccgctgcgccacgtccacgcgctgctgcctgcgcag
acgccggggcaaaagcgcctgcgcgaccagctgggcgccgccatagagcgcagcgactgg
caagggctgcagcaggtcatcaccgcctatgccaacgcggccctgcagccgcccgcctat
gaggccaggcccgtggagctgcccgtgccgccgcccgtccaggccctgcccgacgacctg
acccagcagttggcgcggcgcttcgaggccttgtccacgctgctggacacccaggacacc
aaaaccgggcaactgcaccagcagctgatggagcagctgcaatcgccgcccgtggatgcc
aaggccctggcgcggcgcctgcacgaccagcactaccagctgtcgttcgccatcgccgac
cagcttcaggtcctgcagttgatgcaggagttgctgcagaccctggtgcagcacctggcc
caggaccccacgcatggcagctggctggtgcagcagctcacggccatcgagcaggccatc
accccgccgctgtcgcccgcgcctctggccgatgcacggcgcgagctgcagaccgtgatc
caccggcgcctgcagttgcaggacggcatggccgccgcgcagcaggcgctcagggacatg
ctgggcggcttcgtccagcacctggcgcagatcacgagcagcaacgaaacgctgggcgcc
cgcatggaagaggcggcacgccagctggacggcatccagcgcctggaagatgcagccccg
ctgctgcagcaggtgctggaggccacgcgcaccatggccgccggcagccgcgtggctcag
gaggagctgcaggcgctgcgcgcccatgtcgatgcctgcgaggcccgcatcgaaacactg
cagcaggagctggacgaggccgcgcgccgcgcacgccacgacccgctgaccggccagctc
aaccgcctgggcgtgagcgaggcactggaccgcgaggtggcacgcgcacagcgccatggc
cagccgctgagcgttgccctggtcgatatggacggcatgcaggccctcaatgccgagctg
gggcacgccatgggcgatgccgcgctggtgcatgtggcccagctggcacgccaagggctg
cgcccggaagacgtggtgggccgctatgaaggccaggccttcgtgctgctgctgccgcag
accccggagacggcgggcgcccaggcgctgcagcgccttctgcagttgctggagcaggcg
cctttgcccgcatctgcgcagaccccaggccagcccgcaccccggcccctgagcttcagc
gcgggcgtggcccagttgcaaggccacgaaaacggcatggacgtgctgcgccgcgccgac
accgccatgctgcaggccaaggagcggggcaagcactgcattgccacggcatcaggcgca
caatcgcagccagttggaaatgcaggcgccggcctttga

DBGET integrated database retrieval system