KEGG   Delftia acidovorans: Daci_5031Help
Entry
Daci_5031         CDS       T00620                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
dac  Delftia acidovorans
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5568411..5570009
Genome map
AA seq 532 aa AA seqDB search
MAERSASELARETLRQLALNRLPPTPENYTRLYEQAAGEPGPASFPQGPLRHVHALLPAQ
TPGQKRLRDQLGAAIERSDWQGLQQVITAYANAALQPPAYEARPVELPVPPPVQALPDDL
TQQLARRFEALSTLLDTQDTKTGQLHQQLMEQLQSPPVDAKALARRLHDQHYQLSFAIAD
QLQVLQLMQELLQTLVQHLAQDPTHGSWLVQQLTAIEQAITPPLSPAPLADARRELQTVI
HRRLQLQDGMAAAQQALRDMLGGFVQHLAQITSSNETLGARMEEAARQLDGIQRLEDAAP
LLQQVLEATRTMAAGSRVAQEELQALRAHVDACEARIETLQQELDEAARRARHDPLTGQL
NRLGVSEALDREVARAQRHGQPLSVALVDMDGMQALNAELGHAMGDAALVHVAQLARQGL
RPEDVVGRYEGQAFVLLLPQTPETAGAQALQRLLQLLEQAPLPASAQTPGQPAPRPLSFS
AGVAQLQGHENGMDVLRRADTAMLQAKERGKHCIATASGAQSQPVGNAGAGL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggccgagcgctccgcttccgaactggcacgcgaaaccctgcggcaactggcgctgaac
cgcctgccgcccacaccggaaaactacacccgcctttatgaacaggcggctggcgagccc
ggccccgccagctttccccagggcccgctgcgccacgtccacgcgctgctgcctgcgcag
acgccggggcaaaagcgcctgcgcgaccagctgggcgccgccatagagcgcagcgactgg
caagggctgcagcaggtcatcaccgcctatgccaacgcggccctgcagccgcccgcctat
gaggccaggcccgtggagctgcccgtgccgccgcccgtccaggccctgcccgacgacctg
acccagcagttggcgcggcgcttcgaggccttgtccacgctgctggacacccaggacacc
aaaaccgggcaactgcaccagcagctgatggagcagctgcaatcgccgcccgtggatgcc
aaggccctggcgcggcgcctgcacgaccagcactaccagctgtcgttcgccatcgccgac
cagcttcaggtcctgcagttgatgcaggagttgctgcagaccctggtgcagcacctggcc
caggaccccacgcatggcagctggctggtgcagcagctcacggccatcgagcaggccatc
accccgccgctgtcgcccgcgcctctggccgatgcacggcgcgagctgcagaccgtgatc
caccggcgcctgcagttgcaggacggcatggccgccgcgcagcaggcgctcagggacatg
ctgggcggcttcgtccagcacctggcgcagatcacgagcagcaacgaaacgctgggcgcc
cgcatggaagaggcggcacgccagctggacggcatccagcgcctggaagatgcagccccg
ctgctgcagcaggtgctggaggccacgcgcaccatggccgccggcagccgcgtggctcag
gaggagctgcaggcgctgcgcgcccatgtcgatgcctgcgaggcccgcatcgaaacactg
cagcaggagctggacgaggccgcgcgccgcgcacgccacgacccgctgaccggccagctc
aaccgcctgggcgtgagcgaggcactggaccgcgaggtggcacgcgcacagcgccatggc
cagccgctgagcgttgccctggtcgatatggacggcatgcaggccctcaatgccgagctg
gggcacgccatgggcgatgccgcgctggtgcatgtggcccagctggcacgccaagggctg
cgcccggaagacgtggtgggccgctatgaaggccaggccttcgtgctgctgctgccgcag
accccggagacggcgggcgcccaggcgctgcagcgccttctgcagttgctggagcaggcg
cctttgcccgcatctgcgcagaccccaggccagcccgcaccccggcccctgagcttcagc
gcgggcgtggcccagttgcaaggccacgaaaacggcatggacgtgctgcgccgcgccgac
accgccatgctgcaggccaaggagcggggcaagcactgcattgccacggcatcaggcgca
caatcgcagccagttggaaatgcaggcgccggcctttga

DBGET integrated database retrieval system