KEGG   Delftia acidovorans: Daci_5032Help
Entry
Daci_5032         CDS       T00620                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
dac  Delftia acidovorans
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daci_5032
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Daci_5032
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Daci_5032
Enzymes [BR:dac01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Daci_5032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5570070..5571704
Genome map
AA seq 544 aa AA seqDB search
MHLPFSASVPAPRRQFLVGSGLATALGQLPAWARLGERPAHNPFTLGVASGDPEPDNVLL
WTRLTPPLSQLGETDTTAMPALKIRWELAHDPLFRHIVRSGEAMAQPEWGHGVHVQVGGL
APDRWYHYRFMLGQAVSGTGRCRTAPAPGSMPQRLRLAYASCQRWEHGYYAAWRQVVQDA
PDLVIFLGDYIYEYATPAMTLGLARTHNLRAAQTLQDYRDRYALHKSDPLLQAAHALCNW
SVGWDDHEVENNYAGDQGQGDAARFLARRMAAWQAFYENMPLRASALTGAGASHGGGGLQ
LYRSLQWGRLARLHLLDGRQYRSAQACRTEGEADKGSVRPAQCAALSDTARSFLGWTQEQ
WLYRQLAEDARHQGSEGPRWSILAQPTLLSAHRPPSGSQATDSWDGYPAARQRLVRHLTP
GAQPTPRNSVLLGGDLHQNYVCAVHADPEAAPERRNPIVASEFCSTSITSRSGTTQAKVD
AIVAHNPQVLYARCEERGYGLADITPERWTSELRAVANPMRADSRIYTLARFTVEDRRPG
PVAS
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgcacctgcccttcagcgcctccgtccctgcaccgcggcgccagtttctggtcggctcg
ggcctggccacggcgctgggccagttgcctgcctgggcccggctgggcgagcggcctgcg
cacaaccccttcacgctgggcgtggccagcggcgaccccgaacccgacaacgtgctgctg
tggacgcggctgacgccaccgctgtcccagctgggcgagaccgacaccacggccatgcct
gcgctcaagatccgctgggagctggcgcacgacccgctgttccgccacatcgtgcgcagc
ggcgaggccatggcccagcccgaatggggccacggcgtgcatgtgcaggtgggaggactg
gcgcccgaccgctggtaccactaccgcttcatgctgggacaggcggtcagcggcacgggc
cgctgccgcacggcgcccgcccccggcagcatgccgcagcgcctgcgcctggcctatgcc
tcctgccagcgctgggagcacggctactacgcggcctggcgccaggtggtgcaggatgcg
ccggacctggtgatcttcctgggcgactacatctacgaatacgccacgcccgccatgacg
ctgggcctggcccgcacgcacaacctgcgcgccgcgcagaccctgcaggactaccgcgac
cgctacgccctgcacaagagcgacccgctgctgcaggccgcgcacgccctgtgcaactgg
tccgtgggctgggacgaccatgaggtggaaaacaactacgcgggcgaccagggccagggc
gatgccgcgcgtttcctggcccggcgcatggccgcctggcaggccttctacgaaaacatg
ccgctgcgtgccagcgcgctgacgggcgccggggcatcgcatggcggcggcggcctgcag
ctgtaccgcagcctgcaatggggccggctggcccggctgcatctgctggacggccgccag
taccgcagcgcccaggcctgccgcaccgagggcgaggcagacaagggcagcgtgcgccct
gcgcaatgtgcggccctgtcggacacggcgcgcagcttcctgggctggactcaggagcag
tggctgtaccgccaactggccgaggacgcacgccaccagggcagcgaggggccgcgctgg
agcatcctggcccagcccaccctgctgtcggcgcaccggccgccctcgggatcgcaggcc
acggacagctgggacggctacccggccgcgcgccagcgcctggtgcgccacctcacgccg
ggcgcccagcccacgccgcgcaacagcgtgctgctgggcggcgacctgcaccagaactac
gtctgtgccgtgcatgccgatcccgaggccgcgcccgaacggcgcaaccccatcgtggcc
agcgagttctgcagcacctcgatcacctcgcgcagcggcaccacacaggccaaggtcgat
gccatcgtcgcccacaacccgcaggtgctgtacgcacgctgcgaggaacgcggctatggc
ctggcagacatcacgcccgaacgctggaccagcgagctgcgtgccgtggccaaccccatg
cgcgccgacagccgcatctacacgctggcccgcttcaccgtcgaggacaggcggcccggc
cccgtagccagctga

DBGET integrated database retrieval system