KEGG   Delftia acidovorans: Daci_5122Help
Entry
Daci_5122         CDS       T00620                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
dac  Delftia acidovorans
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:dac00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5674519..5675589
Genome map
AA seq 356 aa AA seqDB search
MTLFTPDRLQALRARFGGANESVIHDPHFRAVAAHIIDASGTRNAPYAGMPTLLDAPMRP
MDWSRPDFGDLQAALIGVPMDLGISNRSGCRFGPRALRSIERVGPYNHVLRSAPTRELRV
ADIGDVPLSSRYSLEQSHRDIESIFAKIHAAGVIPLSAGGDHSITLPILRALGRERPLAL
VHFDAHCDTGGPFDGSRFHHGGPFRQAVLDGVLDPTRTIQIGIRGAAEYLWEFSYESGMT
VIHAEELPALGVDGVIARAREVVGDTPVYVSFDIDCLDPAFAPGTGTPEVGGITVREAQA
MVRGLAGIHIVGGDVVEVSPAYDATTNTAHAGAQMMFEILGLICARHAGSGAAQPA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacgcttttcacaccagacaggctgcaggcgctgcgcgcacgcttcggcggcgccaac
gagtccgtgatccacgacccgcatttccgcgccgtggccgcccacatcatcgacgccagc
ggcacgcgcaacgcgccctacgcaggcatgcccacgctgctggacgcgcccatgcgtccc
atggactggagccgcccggatttcggcgacctccaggccgcgctgatcggcgtgcccatg
gacctgggcatcagcaaccgcagcggctgccgcttcggcccccgggccctgcgttccatc
gaacgcgtgggcccctacaaccatgtgcttcgatccgctcccacacgcgagctgcgcgtg
gcggacatcggcgacgtgccgctgtccagccgctacagcctggagcagtcgcaccgcgac
atagagtcgatcttcgcgaagatccatgcggccggcgtgattccgctgtctgcgggcgga
gaccactccatcaccctgcccatactgcgcgcactgggccgcgagcggccactggccctg
gtgcatttcgacgcccactgcgacaccgggggccccttcgacggcagccgcttccaccac
ggcggcccgtttcgccaggccgtgctggacggcgtgctcgaccccacgcggaccattcag
atcggcatacgcggcgcggccgaatatctctgggagttttcctatgagtcgggcatgacc
gtgatccacgcagaggagcttcccgcgctgggcgtggacggcgtcattgcccgcgcacgc
gaggtggtgggcgatacgcccgtctacgtctccttcgacatcgactgcctggacccggcc
tttgcgcccggcacgggcacgcccgaggtcggtggaatcaccgtgcgcgaggcacaggcc
atggtgcgcggcctggccggcatccacatcgtgggcggcgatgtggtggaggtgtcgccc
gcctacgacgccaccaccaacaccgcccatgcgggcgcgcagatgatgttcgaaatcctc
ggcctgatctgcgcacgccacgccgggagtggcgccgcccagcctgcctag

DBGET integrated database retrieval system