KEGG   Delftia acidovorans: Daci_5244Help
Entry
Daci_5244         CDS       T00620                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dac  Delftia acidovorans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Daci_5244
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daci_5244
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daci_5244
Enzymes [BR:dac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daci_5244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5812322..5813131
Genome map
AA seq 269 aa AA seqDB search
MSRITTTFAKLQEEGRKALIPYITAGFPFAAITPSLMHGMVEAGADVIELGVPFSDPMAD
GPTIQKAGDRAIANGVGLVQVLAYVREFRQKNQTTPVVLMGYANPVERYDQIHGKDRFVD
DAAEAGVDGLLIVDYPPEECEAFAAQLRARDMDLIFLLAPTSTTERMQQVARVASGYVYY
VSLKGVTGSGALDTAAVEAMLPRIREHVSIPVGVGFGIRDAATAQAISRVADAVVIGSRI
IEMLDGQPHEKIVPLTIDFLRGVRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcaccacgactttcgccaaactccaggaagaaggccgcaaggccctgatc
ccctacatcaccgcaggcttcccgttcgcggccatcacgccgtcgctgatgcacggcatg
gtggaggctggcgccgacgtgatcgagctgggcgtgcccttctcggaccccatggccgac
ggccccaccatccagaaggcaggcgaccgcgccatcgccaatggcgtgggcctggtgcag
gtgctggcctatgtgcgcgagttccgccagaagaaccagaccacgcccgtggtgctgatg
ggctacgccaacccggtggagcgctacgaccagatccacggcaaggaccgcttcgtggac
gatgcggccgaggccggcgtcgacggcctgctcatcgtggactacccgcccgaggagtgc
gaggcattcgccgcgcaactgcgtgcgcgcgacatggacctcatcttcctgctggcgccc
acctccaccaccgagcgcatgcagcaggtggcgcgcgtggccagcggctatgtctactac
gtctcgctcaagggcgtgaccggctcgggcgcgctcgacacggcagccgtggaagccatg
ctgccgcgcatccgcgagcatgtgagcattcccgtgggcgtgggcttcggcatccgcgac
gcggccacggcacaggccatatcccgcgtggccgatgccgtggtcatcggcagccgcatc
atcgagatgctggacggccagccccacgaaaagatcgtccccctgaccatcgacttcctg
cgcggcgtgcgcaaggcactcgacgcgtag

DBGET integrated database retrieval system