KEGG   Delftia acidovorans: Daci_5244Help
Entry
Daci_5244         CDS       T00620                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dac  Delftia acidovorans
Pathway
dac00260  Glycine, serine and threonine metabolism
dac00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01130  Biosynthesis of antibiotics
dac01230  Biosynthesis of amino acids
Module
dac_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Daci_5244
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Daci_5244
Enzymes [BR:dac01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Daci_5244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB BtpA
Motif
Other DBs
NCBI-ProteinID: ABX37873
UniProt: A9BNH8
Position
5812322..5813131
Genome map
AA seq 269 aa AA seqDB search
MSRITTTFAKLQEEGRKALIPYITAGFPFAAITPSLMHGMVEAGADVIELGVPFSDPMAD
GPTIQKAGDRAIANGVGLVQVLAYVREFRQKNQTTPVVLMGYANPVERYDQIHGKDRFVD
DAAEAGVDGLLIVDYPPEECEAFAAQLRARDMDLIFLLAPTSTTERMQQVARVASGYVYY
VSLKGVTGSGALDTAAVEAMLPRIREHVSIPVGVGFGIRDAATAQAISRVADAVVIGSRI
IEMLDGQPHEKIVPLTIDFLRGVRKALDA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcaccacgactttcgccaaactccaggaagaaggccgcaaggccctgatc
ccctacatcaccgcaggcttcccgttcgcggccatcacgccgtcgctgatgcacggcatg
gtggaggctggcgccgacgtgatcgagctgggcgtgcccttctcggaccccatggccgac
ggccccaccatccagaaggcaggcgaccgcgccatcgccaatggcgtgggcctggtgcag
gtgctggcctatgtgcgcgagttccgccagaagaaccagaccacgcccgtggtgctgatg
ggctacgccaacccggtggagcgctacgaccagatccacggcaaggaccgcttcgtggac
gatgcggccgaggccggcgtcgacggcctgctcatcgtggactacccgcccgaggagtgc
gaggcattcgccgcgcaactgcgtgcgcgcgacatggacctcatcttcctgctggcgccc
acctccaccaccgagcgcatgcagcaggtggcgcgcgtggccagcggctatgtctactac
gtctcgctcaagggcgtgaccggctcgggcgcgctcgacacggcagccgtggaagccatg
ctgccgcgcatccgcgagcatgtgagcattcccgtgggcgtgggcttcggcatccgcgac
gcggccacggcacaggccatatcccgcgtggccgatgccgtggtcatcggcagccgcatc
atcgagatgctggacggccagccccacgaaaagatcgtccccctgaccatcgacttcctg
cgcggcgtgcgcaaggcactcgacgcgtag

DBGET integrated database retrieval system