KEGG   Delftia acidovorans: Daci_5255Help
Entry
Daci_5255         CDS       T00620                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Daci_5255
   01230 Biosynthesis of amino acids
    Daci_5255
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Daci_5255
   00030 Pentose phosphate pathway
    Daci_5255
   00051 Fructose and mannose metabolism
    Daci_5255
   00052 Galactose metabolism
    Daci_5255
  Energy metabolism
   00680 Methane metabolism
    Daci_5255
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Daci_5255
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Daci_5255
Protein phosphatases and associated proteins [BR:dac01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Daci_5255
Messenger RNA biogenesis [BR:dac03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Daci_5255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5823106..5824203)
Genome map
AA seq 365 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLINHGQCEVLGIADGFEGLMLDPPGVKPLGWDEVS
GILHVGGTILGTSNSANPLRDAATLEHVGRNVRALGLDVVVAIGGDGTMSLAHGLAEQVG
LTCVGVPKTIDNDIANCERSFGFDTAVATATEALRRIESTANSHHRVMIVETMGRHAGWL
ALEAGIAGAADVILLPEIDFDLQAIVDFCRGREQRQRYTIICIGEGAKESGASLTVRERI
EQSPDPVRLGGVGHVLRERLQPHLRSEVRTTVLGHVQRGGDPTPFDRVLATQYGHHAAQL
VLSGRFGRMVTLQGGEIGSVEISRVANTQRTVPLDHGLLTMARDIGICLGEPCKQDARPA
AAGSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttggcgtgctgaccggaggtggcgactgccccggcctgaatgcggtgatccgt
gcggtcaccaagtccctgatcaaccacggccagtgcgaggtgctgggcattgccgatggc
ttcgagggcctgatgctcgacccgcccggcgtcaagcccctgggctgggacgaggtctcg
ggcatcctgcatgtgggcggcaccatcctgggcaccagcaacagcgccaaccccctgcgc
gatgcggccacgctggagcatgtgggccgcaatgtccgggcgctgggcctggacgtggtg
gtggccatcggcggcgacggcaccatgagcctggcgcatggcctggccgaacaggtgggg
ctgacctgcgtgggcgtgcccaagaccatcgacaacgacattgccaattgcgagcgcagc
tttggcttcgacaccgccgtggccacggccaccgaggcgctgcgccgcatcgagagcacg
gccaacagccaccaccgcgtgatgatcgtcgagaccatggggcgccatgccggatggctg
gcgctggaggccggcattgccggcgcggccgacgtcatcctgctgcccgagatcgatttc
gacctgcaggccatcgtcgacttctgccggggccgcgagcagcgccagcgttacaccatc
atctgcatcggcgagggcgccaaggaaagcggcgccagcctcacggtgcgcgagcgcatc
gagcaaagccccgacccggtccgcctgggcggtgtcggccatgtgctgcgcgagcgcctg
cagccccacctcaggagcgaggtgcgcaccacggtcctcggccatgtacagcgcggcggc
gaccccacgccctttgaccgcgtgctggccacgcagtacggccaccatgcggcgcaactg
gtgctgtcggggcgcttcggccgcatggtcacgctgcagggtggcgagatcggcagcgtg
gaaatctcccgcgtggccaacacccagcgcaccgtgcccctggaccacggcctgctcacc
atggcgcgcgacataggcatttgcctgggcgagccatgcaagcaggatgcgcggccggcc
gcagccggcagccactga

DBGET integrated database retrieval system