KEGG   Delftia acidovorans: Daci_5255Help
Entry
Daci_5255         CDS       T00620                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dac  Delftia acidovorans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:dac01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:dac01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:dac00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:dac00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:dac00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dac00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:dac00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5823106..5824203)
Genome map
AA seq 365 aa AA seqDB search
MRVGVLTGGGDCPGLNAVIRAVTKSLINHGQCEVLGIADGFEGLMLDPPGVKPLGWDEVS
GILHVGGTILGTSNSANPLRDAATLEHVGRNVRALGLDVVVAIGGDGTMSLAHGLAEQVG
LTCVGVPKTIDNDIANCERSFGFDTAVATATEALRRIESTANSHHRVMIVETMGRHAGWL
ALEAGIAGAADVILLPEIDFDLQAIVDFCRGREQRQRYTIICIGEGAKESGASLTVRERI
EQSPDPVRLGGVGHVLRERLQPHLRSEVRTTVLGHVQRGGDPTPFDRVLATQYGHHAAQL
VLSGRFGRMVTLQGGEIGSVEISRVANTQRTVPLDHGLLTMARDIGICLGEPCKQDARPA
AAGSH
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgttggcgtgctgaccggaggtggcgactgccccggcctgaatgcggtgatccgt
gcggtcaccaagtccctgatcaaccacggccagtgcgaggtgctgggcattgccgatggc
ttcgagggcctgatgctcgacccgcccggcgtcaagcccctgggctgggacgaggtctcg
ggcatcctgcatgtgggcggcaccatcctgggcaccagcaacagcgccaaccccctgcgc
gatgcggccacgctggagcatgtgggccgcaatgtccgggcgctgggcctggacgtggtg
gtggccatcggcggcgacggcaccatgagcctggcgcatggcctggccgaacaggtgggg
ctgacctgcgtgggcgtgcccaagaccatcgacaacgacattgccaattgcgagcgcagc
tttggcttcgacaccgccgtggccacggccaccgaggcgctgcgccgcatcgagagcacg
gccaacagccaccaccgcgtgatgatcgtcgagaccatggggcgccatgccggatggctg
gcgctggaggccggcattgccggcgcggccgacgtcatcctgctgcccgagatcgatttc
gacctgcaggccatcgtcgacttctgccggggccgcgagcagcgccagcgttacaccatc
atctgcatcggcgagggcgccaaggaaagcggcgccagcctcacggtgcgcgagcgcatc
gagcaaagccccgacccggtccgcctgggcggtgtcggccatgtgctgcgcgagcgcctg
cagccccacctcaggagcgaggtgcgcaccacggtcctcggccatgtacagcgcggcggc
gaccccacgccctttgaccgcgtgctggccacgcagtacggccaccatgcggcgcaactg
gtgctgtcggggcgcttcggccgcatggtcacgctgcagggtggcgagatcggcagcgtg
gaaatctcccgcgtggccaacacccagcgcaccgtgcccctggaccacggcctgctcacc
atggcgcgcgacataggcatttgcctgggcgagccatgcaagcaggatgcgcggccggcc
gcagccggcagccactga

DBGET integrated database retrieval system