KEGG   Delftia acidovorans: Daci_5256Help
Entry
Daci_5256         CDS       T00620                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
dac  Delftia acidovorans
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dac00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:dac00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5824315..5825406)
Genome map
AA seq 363 aa AA seqDB search
MTEHAPLIIDIAGKALTDVDRQRLAHPLVGGIILFARNWESRDQLVQLCADIKAVKPDLL
ICVDHEGGRVQRFRADGFTHLPPMRAFGQMWMDDGQGSKHREGSGALAAMNAATAAGYVL
GTELRACGVDFSFTPVLDLDYGASSVIGDRSFHRDPRVVAALARSLMHGLLQAGMGNCGK
HFPGHGFVKADSHVDIPVDGRSLTAILGEDAAPYPWLSSVLTAVMPAHVIYPKVDKRPAG
FSAKWLKDILRSRLRYDGAIFSDDLSMEGARRIDGQLIGYTDAALAALEAGCDMVLLCNQ
SLGLGEHVDELLAGMEAAQRSGRWQPDADSESRRVALLPETVPQPWDDLMRQPAYLQALD
LLP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagcacgcacccctcatcatcgacatcgccggcaaggcactcaccgatgtggac
cgccagcgcctggcgcatccgctggtcggcggcatcatcctctttgcccgcaactgggaa
agccgcgatcagctggtgcagctgtgcgccgatatcaaggcggtgaagcccgatttgctg
atctgcgtggaccatgagggcgggcgcgtgcagcgttttcgcgctgacggcttcacgcac
ctgccgcccatgcgcgccttcggccagatgtggatggacgacggccagggcagcaagcac
cgtgaaggcagcggcgccctggccgccatgaatgccgccacggcggccggctacgtgctg
ggcaccgagctgcgtgcctgcggcgtggatttcagcttcaccccggtgctggaccttgac
tatggtgccagcagcgtcatcggcgaccgcagcttccaccgcgacccgcgcgtggtggcc
gcgctggcccgcagcctcatgcacggcctgctgcaggccggcatgggcaactgcggcaag
cactttcccggccacggcttcgtcaaggctgattcgcatgtggacattccggtcgatggc
cgcagcctcaccgccatcctgggcgaggacgccgcgccctatccctggttgtccagcgtg
ctcacggccgtgatgccggcccacgtgatctaccccaaggtcgacaagcgcccggccggt
ttttctgccaagtggctcaaggacatcctgcgcagccgcctgcgctacgacggcgccatt
ttcagcgacgacctgagcatggagggcgcgcgccgcatcgacggccagctcatcggctac
accgacgcggccctggccgcgctggaggcgggctgcgacatggtgctgctgtgcaaccag
agcctgggcctgggcgagcatgtggatgagctgctggccggcatggaggccgcgcagcgc
agcggccgctggcagcccgatgccgacagcgaatcgcgccgcgtggccctgctgccggag
accgtgccccagccctgggacgacctcatgcgccagcctgcctatctgcaggcgctggac
ctgctgccttga

DBGET integrated database retrieval system