KEGG   Delftia acidovorans: Daci_5432Help
Entry
Daci_5432         CDS       T00620                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dac  Delftia acidovorans
Pathway
dac00900  Terpenoid backbone biosynthesis
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Daci_5432
Enzymes [BR:dac01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Daci_5432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C EF-hand_1
Motif
Other DBs
NCBI-ProteinID: ABX38061
UniProt: A9BP16
Position
6031681..6032544
Genome map
AA seq 287 aa AA seqDB search
MRSLHDVPAPAKLNLFLHITGRRADGYHLLQSVFMLLDWHDTLHFDRRGDGQISREDLSG
MALPADDLIVRAARALQQATGCRAGVHIGVEKRLPAQAGMGGGSSDAASTLIALNRLWQL
NLTRRELQRIALDLGADVPFFLCGNSAWVEGIGEHITPLEQAHALPPQRFVVVKPEAGLE
TLSIFRDATLKRDHAHATIEDFAADHYGFGQNDLQPVAERLQPEVKKAIDWLNSLKLHAR
MTGSGSAVFAPLTQTIDLKDAPGAWNVRVCSNLQAHPLKDWLKDESL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgcgctcgctccacgacgtgccggctccggccaagctcaacctgttcctccacatcacc
ggccgccgcgccgatggctatcaccttctgcaatcggtcttcatgctgttggactggcat
gacacgctgcatttcgacaggcgtggcgacggccagatcagccgcgaggacctgtcgggc
atggcacttcctgccgacgatctcatcgtgcgggccgcacgggctctgcagcaggccacc
ggctgccgcgcgggcgtgcacatcggcgtggaaaagcgcctgccggcgcaggccgggatg
ggcgggggctcgtcggatgcggcatcgaccctgatcgcactgaaccgcctgtggcagttg
aacctgacgcggcgcgagctgcagcgcattgcactggacctgggcgccgatgtgcccttc
tttctgtgcggcaactccgcctgggtggaaggtataggcgagcacatcacgccgctggaa
caggcccacgccctgccgccccagcggttcgtggtggtcaagcccgaggcggggctggag
accctgtccatcttccgcgacgcaaccctcaagcgcgatcatgcccatgctacaatcgaa
gactttgctgcagatcactatggctttggccaaaacgacttgcagcctgtcgccgaaagg
ctgcagcctgaagtgaaaaaagccatcgattggctaaactcactaaaactgcatgctaga
atgacgggctcaggaagtgcagtatttgcaccactgacgcaaacgattgacttaaaggat
gcccctggcgcctggaatgtcagagtttgcagcaatctgcaggcccatcctctcaaggat
tggctgaaagatgaaagtttatag

DBGET integrated database retrieval system