KEGG   Delftia acidovorans: Daci_5449Help
Entry
Daci_5449         CDS       T00620                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dac  Delftia acidovorans
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daci_5449
Enzymes [BR:dac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Daci_5449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6048531..6049262)
Genome map
AA seq 243 aa AA seqDB search
MPAMFRELVDMKQDSQAEGTPVSVKIRERLKQAQKRFHANDNISEFIEPGELELLLDEVQ
DKMQGVLDSMVIDTTHDHNTRATARRVAKMYVNEVFRGRYVAQPAITEFPNAEHLNELMI
VGPITVRSACSHHLCPVIGKIWIGVLPNKNTNVIGLSKYARLVDWIMGRPQIQEEAIIQL
ADLILDKTRPDGLAVVMEASHFCMSWRGVREMDSKMLNSVMRGAFLTNPELRREFLSLVS
SRR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccagccatgttcagagaactcgtcgacatgaaacaagacagccaggccgagggcacc
cccgtctcggtcaagatccgcgaacggttgaagcaggcgcaaaagcgctttcatgcgaac
gacaacatctccgaattcatcgagcccggtgaactcgagctgctgctcgacgaagtccag
gacaagatgcagggcgtgctcgacagcatggtcatcgacaccacgcacgaccacaacacg
cgcgccacggcgcgccgcgtggccaagatgtatgtcaacgaagtgttccgcggccgctat
gtggcgcagcccgccatcaccgagttccccaacgccgagcacctcaacgagctgatgatc
gtcggcccgatcacggtgcgcagcgcctgcagccaccatctgtgcccggtgatcggcaag
atctggatcggcgtgctgcccaacaagaacaccaatgtcatcggcctgtccaagtacgcg
cggctggtggactggatcatgggccgcccccagatccaggaagaggccatcatccagctg
gccgacctgatcctcgacaagacccgccccgacggcctggccgtggtcatggaggcttcg
cacttttgcatgtcctggcgcggtgtgcgcgagatggacagcaagatgctgaactccgtc
atgcgcggcgccttcctcaccaacccggaactgcgccgcgagttcctctcgctggtgtcc
agccgcaggtaa

DBGET integrated database retrieval system