KEGG   Delftia acidovorans: Daci_5449Help
Entry
Daci_5449         CDS       T00620                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
dac  Delftia acidovorans
Pathway
dac00790  Folate biosynthesis
dac01100  Metabolic pathways
Module
dac_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Daci_5449
Enzymes [BR:dac01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Daci_5449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABX38078
UniProt: A9BP33
Position
complement(6048531..6049262)
Genome map
AA seq 243 aa AA seqDB search
MPAMFRELVDMKQDSQAEGTPVSVKIRERLKQAQKRFHANDNISEFIEPGELELLLDEVQ
DKMQGVLDSMVIDTTHDHNTRATARRVAKMYVNEVFRGRYVAQPAITEFPNAEHLNELMI
VGPITVRSACSHHLCPVIGKIWIGVLPNKNTNVIGLSKYARLVDWIMGRPQIQEEAIIQL
ADLILDKTRPDGLAVVMEASHFCMSWRGVREMDSKMLNSVMRGAFLTNPELRREFLSLVS
SRR
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgccagccatgttcagagaactcgtcgacatgaaacaagacagccaggccgagggcacc
cccgtctcggtcaagatccgcgaacggttgaagcaggcgcaaaagcgctttcatgcgaac
gacaacatctccgaattcatcgagcccggtgaactcgagctgctgctcgacgaagtccag
gacaagatgcagggcgtgctcgacagcatggtcatcgacaccacgcacgaccacaacacg
cgcgccacggcgcgccgcgtggccaagatgtatgtcaacgaagtgttccgcggccgctat
gtggcgcagcccgccatcaccgagttccccaacgccgagcacctcaacgagctgatgatc
gtcggcccgatcacggtgcgcagcgcctgcagccaccatctgtgcccggtgatcggcaag
atctggatcggcgtgctgcccaacaagaacaccaatgtcatcggcctgtccaagtacgcg
cggctggtggactggatcatgggccgcccccagatccaggaagaggccatcatccagctg
gccgacctgatcctcgacaagacccgccccgacggcctggccgtggtcatggaggcttcg
cacttttgcatgtcctggcgcggtgtgcgcgagatggacagcaagatgctgaactccgtc
atgcgcggcgccttcctcaccaacccggaactgcgccgcgagttcctctcgctggtgtcc
agccgcaggtaa

DBGET integrated database retrieval system