KEGG   Delftia acidovorans: Daci_5524Help
Entry
Daci_5524         CDS       T00620                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dac  Delftia acidovorans
Pathway
dac00340  Histidine metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
dac01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Daci_5524
Enzymes [BR:dac01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Daci_5524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABX38153
UniProt: A9BX77
Position
complement(6141458..6142774)
Genome map
AA seq 438 aa AA seqDB search
MEYVAAPARLSTADANFEHDFAQRLHWSADTDAAIEQRVADILADVQKRGDAAVLEYTAR
FDGLQVDGMAALELTQAELKAAFNSLGDEQRDALTAAAQRVRTYHEAQKRASGESWSYRD
ADGTLLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPAHVAGVQEIIMVVPTPRGEKNAL
VLAAAYVAGVTRGFTIGGAQAVAALAYGTATIPKVDKITGPGNAYVASAKKRVFGTVGID
MIAGPSEILVLADGSTPPDWVAMDLFSQAEHDELAQSILLCPDADYIAAVQREIDRLLPE
MPRRAIIAKSLSDRGALILTRDMQEACAISNRIAPEHLEVSSNDPHQWEPLLRHAGAIFL
GAYTSESLGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIEVSEQGAQTLGRIASVL
AHGEGLQGHARAAEMRLK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgtagctgcccctgcccgcctgtcgactgcggatgccaacttcgaacacgat
tttgcgcagcgcctgcattggtcggcagacacggacgcggccatcgagcagcgcgtggcc
gacatcctggccgatgtgcaaaagcgtggcgatgcggccgtgctggagtacacggcgcgc
ttcgacggattgcaggtggacggaatggcagcgctggagctgacgcaggctgagctcaag
gccgccttcaacagcctgggtgacgagcagcgcgatgcgctgacggccgccgcccagcgc
gtgcgcacctaccacgaggcacaaaagcgcgccagcggcgaaagctggagctaccgtgac
gccgatggcaccctgctgggccagaaggtcacgccgctggaccgcgtgggcatctatgtg
cccggcggcaaggcggcctatccttccagcgtgctgatgaatgccattcccgcccacgtg
gctggcgtgcaggaaatcatcatggtcgtgcccacgccgcgcggcgagaagaatgccctg
gtgctggccgccgcctatgtggccggcgtcacgcgcggcttcaccatcggcggtgcccag
gccgtggcggccctggcctacggcacggccaccattccgaaggtggacaagatcaccggc
cccggcaatgcctatgtggccagcgccaagaagcgggtgttcggcaccgtgggcatcgac
atgattgccggccccagtgaaatcctggtgctggccgacggcagcacgccgcccgactgg
gtggccatggacctgttcagccaggccgagcatgacgagctggcgcaaagcatcctgctg
tgccccgacgccgactacatcgccgctgtccagcgcgagatcgaccgcctgctgcccgag
atgccgcggcgcgccatcatcgccaagagcctgagcgaccggggtgccctcatcctcacg
cgcgacatgcaggaggcctgcgccatcagcaaccgcatcgcgcccgagcacctggaagtc
tccagcaacgatccccaccagtgggagccgctgctgcgccatgcaggcgccatcttcctg
ggtgcctataccagcgagagcctgggcgactactgcgccggccccaaccatgtgctgccc
accagcggcacggcgcgcttttcttcgccgctgggggtctatgacttccagaagcgatcc
agcctcatcgaggtcagcgagcagggcgcccagaccctgggccgcatcgcctcggtgctg
gcgcatggcgaaggcctgcaaggccatgcgcgtgcggccgaaatgcgtttgaagtag

DBGET integrated database retrieval system