KEGG   Delftia acidovorans: Daci_5745Help
Entry
Daci_5745         CDS       T00620                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
dac  Delftia acidovorans
Pathway
dac00860  Porphyrin and chlorophyll metabolism
dac01100  Metabolic pathways
dac01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dac00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Daci_5745
Enzymes [BR:dac01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Daci_5745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 Sigma54_activat MCM AAA AAA_30 Sigma54_activ_2 AAA_16 AAA_3 DUF5327
Motif
Other DBs
NCBI-ProteinID: ABX38373
UniProt: A9BXU7
Position
complement(6395679..6396839)
Genome map
AA seq 386 aa AA seqDB search
MTASPDLGSGAQPALPPLFPFAAIAGQPLLCQALLLAAIDPQLGGVLIEGPRGTAKSTAA
RALAELIDAAPFVTLPLGASLEHLAGSLDLGQAMAGHALKFAPGLLARAHGGVLYVDEIN
LLPDALVDVLLDAAASGVNVVERDGISHRHAARFVLVGTMNPEEGQLRPQLLDRLGLCVR
LANVQDPAQRQAIVRARLLFDADPAAFRARHADAQAALAAQLRTARERLQPAGALPWSDA
VLQAAGALCIAAQVDGLRADLVLLRAARAWAAWLGDAEVTPEHVQAVAELVLVHRRKPGA
PQPQPQSQPQPQQPSPQQAPSNPPSKSPAQSRPPAESTANGAGDSPPSEADWGAMPPEPV
GLLRVAVPSLLAREAAKVGAPATKKA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcatctcctgacctgggcagcggcgcccagcccgcgctgccgccgctgtttccc
tttgccgccattgccggccagcccctgctgtgccaggcgctgctgctggccgccattgac
ccgcaactgggcggcgtgctgatcgaggggccgcgcggcacggccaagtccacggccgcg
cgcgcgctggccgagctcatcgatgccgcgcccttcgtcacgctgccgctgggcgcctcg
ctggagcatctggccggctcgctggacctgggccaggccatggccggccatgcactcaaa
ttcgcgcccggcctgctggcgcgcgcccatggcggcgtgctctatgtggacgagatcaac
ctgctgcccgatgccctggtcgatgtgctgctggatgccgctgccagcggcgtcaacgtg
gtcgagcgcgacggcatctcgcaccgccacgcggcgcgcttcgtgctggtgggcaccatg
aaccccgaggaaggccagctgcgcccgcagctgctggaccgcctgggcctgtgcgtgcgc
ctggccaatgtgcaggacccggcccagcgccaggccatcgtgcgcgcgcggctgctgttc
gatgccgacccggccgccttccgcgcccgccatgcagacgcccaggccgcgctggccgcg
cagctgcgcacggcacgcgagcgcctgcagccggccggcgcgctgccctggtccgacgcg
gtgctgcaggccgcaggcgcactgtgcattgccgcccaggtggacggcctgcgcgccgac
ctggtgctgctgcgcgccgcccgcgcctgggccgcctggctgggcgacgccgaggtcacg
cccgaacatgtgcaggccgtggccgagctggtgctggtgcaccgccgcaagccgggggcg
ccgcagccgcagccacagtcgcagccgcagccgcagcagccatccccacagcaggcgcca
tcgaatccgccttcgaagtcgccggcacaaagccggccgcctgcagaatccacggccaac
ggcgcaggcgacagcccgccctccgaggccgactggggcgccatgccgcccgagcccgtg
ggcctgctgcgtgtcgccgtgccctcattgctggcccgcgaggccgcaaaggtgggagcg
cccgccacaaaaaaagcctga

DBGET integrated database retrieval system