KEGG   Desulfotomaculum acetoxidans: Dtox_0094Help
Entry
Dtox_0094         CDS       T00986                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:dae00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dtox_0094
DNA repair and recombination proteins [BR:dae03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dtox_0094
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101875..102474
Genome map
AA seq 199 aa AA seqDB search
MLNHSGVVSRLINEFSLLPGVGPKTAQRIAFYLLNAPEEVAHRLAEAVREARDNIKYCSV
CSNLTDVDPCLICSDNKRSKNIICIVQEPRDVIAMEKSRGFKGLYHVLHGAISPMDGIGP
ENLRIKELLSRLHKEKVGELILATNPNVEGDATAFYLARLIKPLGIKVTRIAHGLPVGAC
LEYADGVTLTKALEGRQEI
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctaaaccattccggagtggtaagtcgcctgataaatgagttttctttattgcccggg
gtcggtcctaaaactgctcagagaatagctttttatcttttgaacgcaccggaagaggta
gcccaccggttggctgaggcagtgagggaggcccgtgataacatcaaatactgctccgta
tgcagcaacttaacggacgttgatccttgtcttatttgcagcgacaataagcgcagcaaa
aacattatatgtatagttcaggaacctcgtgatgtcatagctatggaaaagagccgtggc
tttaaaggactctaccatgttctgcacggtgctatctctccgatggacggtattgggccc
gaaaatctgaggatcaaagagcttttgagcagattgcataaggaaaaagtcggagaattg
attctggccaccaaccctaacgtggaaggggatgccacggctttttatttggcgcgatta
attaagcctttaggcattaaggtaaccaggattgctcatggtttaccggtaggtgcttgc
ttggagtatgccgacggggtaactttgaccaaagcattggaaggcaggcaggagatttag

DBGET integrated database retrieval system