KEGG   Desulfotomaculum acetoxidans: Dtox_0201Help
Entry
Dtox_0201         CDS       T00986                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC:2.7.1.148)
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtox_0201
Enzymes [BR:dae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Dtox_0201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
219699..220661
Genome map
AA seq 320 aa AA seqDB search
MPLVIPAYAKINLCLDVLGRRDDGYHEVEMVMQSISLHDLLELSLSEEQENNNMGKIILT
VAGADLPVGEENLVFRTARILQEYTGCRLGCSILLHKKIPVAAGLAGGSADAAAALLGLN
KLWNLDLTVAELYALAAKIGSDVPFCIKGGTVLAKGRGEQLAFLEAAPDMGIILVKPAYG
ISTGEVYSKLNSAVYPQVINTMQKKDITNDTNDIHNMLCLSDLGPPVLRMIKAIKSRQLP
AVCKALYNILEEPAMKMHPNLLDIKNILFEQGAMGVLMSGSGSTIFGITPDLEAAHLLSK
GLSPSLGSIYAVKLQGAREV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggttatacccgcttatgctaaaatcaatctttgtttggatgtgctgggaaga
agggatgacggttatcatgaggtagagatggttatgcaatctatttctctgcatgatttg
ctggagctgtccctctcggaagagcaggaaaataataatatgggcaagattattttgact
gttgcaggtgctgatttgcctgttggtgaggagaatctggtattcaggacggcccgcata
ttgcaggagtatacgggatgccggttgggctgctcaatacttctgcataaaaagataccg
gttgctgccggtcttgccggtgggtccgctgatgctgctgcggcactgctgggtcttaat
aagttatggaatttggatttaactgttgcagaactgtatgctttagcagctaaaattggt
tctgatgtacctttttgtatcaaaggcggtacagtgctggcaaaaggaagaggcgagcag
ttggcttttctggaagccgcacccgatatgggaattattttagttaaacctgcttatgga
atatctaccggggaggtttatagcaagctgaatagcgccgtttatcctcaagttattaat
acgatgcaaaaaaaagatattactaatgatactaatgatatccataacatgttatgcctt
tcggatttgggaccgccggtactaagaatgattaaagccataaaaagcaggcaattgcct
gctgtatgtaaggctttatataatattttggaggaaccggcaatgaaaatgcacccgaac
cttttagatataaaaaacatactatttgaacaaggagcgatgggtgttttaatgtccggc
agcggatcgacaatttttggcatcactcctgatttagaggccgcacatctgctgtctaag
ggcctgagtccttcgcttggatctatttatgcggtgaaattgcagggagcgagagaagta
tga

DBGET integrated database retrieval system