KEGG   Desulfotomaculum acetoxidans: Dtox_0235Help
Entry
Dtox_0235         CDS       T00986                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dae00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
255161..256345
Genome map
AA seq 394 aa AA seqDB search
MSVTIRNVIVHNKKESLAEIISTGADISGCRLMAPKGVHRLIKLTGLSPKQANIIKQQML
SRGGEAAVSRGVIDCSASEAIVLIMGTLKQFDGLVNILKMQPFGLPKIGARIKQVLKNLE
GRSPVEIDCRGKILLLGERTLIMGILNVTPDSFSDGGSFYNHEVAIEHARAMVSEGADII
DLGGESTRPGHESISVEEELDRVIPVLEKLVREIDVPVSIDTTKAEVARRALLAGAHLIN
DQWALRADPDMAHVVAEYDVPLIIMHNQKGTEYNDLMGDMVQFFEESIDTAVNAGLAREK
IIVDPGIGFGKTLEQNLETMRRLDELSCLGCPVLLGTSRKSMIGKVLDLPVDERVEGTAA
TVTLGIANGADIVRVHNVKEMVRVARMTDAMVRR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtaacaattcgtaatgtaattgtacataataaaaaggagtctttggcggagata
atatctaccggtgctgatatatccgggtgtcgcttaatggctcctaaaggagtgcacagg
ctaattaagttaaccggcttaagtcccaagcaggctaatataattaagcagcagatgttg
agcagaggtggggaggccgcagtatccagaggagttatagactgctctgcctctgaggca
atagtattgattatgggtaccttaaagcagtttgacggacttgtgaatatattaaaaatg
cagccctttggtctgcccaaaatcggtgcacggattaaacaagtattaaaaaacctggaa
ggcagatctcctgtggaaatagactgccggggaaagatcctccttctgggtgaacgcaca
ttaatcatgggaattttgaatgtgactccggattctttttcggatgggggaagtttttat
aaccatgaagttgcaattgaacatgccagggcaatggtgtccgaaggagcggacataata
gacttgggaggagagtcaacacgaccgggtcatgaatccatcagtgtggaagaagaatta
gaccgggtaatacctgttttggaaaaactggttagagaaattgatgttcctgtttccatt
gatacaaccaaggcagaagtagcgcgtcgcgctttgcttgccggtgctcatctgattaac
gatcagtgggctttaagggcagacccggatatggctcatgtagtagcggaatacgatgtt
cctttaattatcatgcataaccaaaaaggtacagagtacaatgatctcatgggtgatatg
gtgcagttttttgaagaaagtatagatacagcggtaaatgccgggttagccagagaaaag
ataattgttgatcccggcattggttttggcaaaacgctggaacagaatcttgaaaccatg
cgaagattagatgaattgtcttgtttgggttgtccggtactcctgggtacttcgcgtaag
tcaatgatcggcaaggttcttgatctgcctgttgatgagcgggtggagggtactgcggct
acggtaacactgggcatagctaacggtgctgatattgtgcgggtgcataatgttaaagaa
atggttcgtgtcgccagaatgactgatgcgatggtgagaagataa

DBGET integrated database retrieval system