KEGG   Desulfotomaculum acetoxidans: Dtox_0615Help
Entry
Dtox_0615         CDS       T00986                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:dae00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dtox_0615
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Dtox_0615
Enzymes [BR:dae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Dtox_0615
Two-component system [BR:dae02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Dtox_0615
Bacterial motility proteins [BR:dae02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Dtox_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
643289..644332
Genome map
AA seq 347 aa AA seqDB search
MIKKKIKVLVVDDSLVFRETLAKSISKDPGIEVVGTASDPFMARDKILELEPDVLTLDVE
MPKMSGIEFLKRLMPQYPIPVIMVSSVGENVFDALNAGAVDFVAKPNFGIEKGIDALINE
LIVKIKIASTARLSHWKNKSTCSGIVGKDNGHAGNSIIAIGASTGGTEAILSILKQFPGN
MPGIVIVQHMPPVFTKMYAQRLNNSCLLEVKEAQKGDRVLPGTVLIAPGDYHMRIKKAGD
NYSVECLKGEKVNGHCPSVDVLFESVAEKAGSAAIGVILTGMGHDGARGLLSMRKKGALT
IGQNEETCVVYGMPKVAYEIGAVQKQSSLLSIPQLIYSMLDNIQKYR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgataaagaaaaaaattaaggttcttgtggtggatgattcccttgtgttcagggagaca
ctggctaaaagcatttcgaaagatccggggattgaggttgtcggtacggcttcggatcct
tttatggccagagataagatactggaattggaacctgatgtgttaactcttgatgtcgaa
atgccgaagatgagcgggattgaattcttaaaaaggcttatgcctcagtatcccattcct
gtcataatggtaagttctgtgggtgaaaatgtttttgatgcgctcaatgcgggcgcagtg
gattttgttgccaagccaaatttcggaatagaaaaaggcattgatgctttgatcaatgaa
ttaatagttaagattaagatagcttccacagctcgattaagtcattggaagaataaatca
acctgcagcggcatagtgggaaaagataacggccatgccggcaattctatcattgccatt
ggagcttctacaggcggcacggaagctatcttaagtatattaaaacagtttcccggaaat
atgcccggcatagtaattgtgcagcacatgcctccggtttttacaaaaatgtatgctcaa
agacttaataatagctgcctcctggaagtcaaagaagctcagaaaggtgacagggtgctt
cccggaactgttttaattgcacccggggattaccatatgagaatcaagaaggccggagat
aattattcagttgaatgtttaaaaggtgaaaaggttaacggtcactgtccttcagtggat
gtgctttttgaatctgtagctgaaaaggcgggttctgctgccataggagtaattttaacc
ggcatggggcatgacggtgccagggggttgctttccatgcggaaaaaaggagccctcacg
attgggcaaaatgaggaaacatgtgtggtttacggcatgcccaaggtagcttatgagata
ggagcggtgcaaaaacagtcgtcacttttgtccataccacagcttatatattccatgttg
gataacattcaaaaatatagataa

DBGET integrated database retrieval system