KEGG   Desulfotomaculum acetoxidans: Dtox_0656Help
Entry
Dtox_0656         CDS       T00986                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:dae02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:dae02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
679258..680298
Genome map
AA seq 346 aa AA seqDB search
MAKIKVLIVDDSALIRNLISRLLEEQGEFQVIGTARNGKEALERIPQLKPDVVTMDVEMP
EMDGLAALRRLMRQNPVPVVMLSAHTFAGAKATIDALAYGAVDFVAKPSKSSELGKMVSD
LAVKLKIAAKVAMKRMTGRPVVSRVTRPATASRSGKTDLLVIGSSTGGPAALQTLVPALP
KDFPSAVVLVQHFPVGFSQALAESLGRRCRLTVSHAVHGEAVRPGHVLVAPAGMEFTFQG
RPGSVTVNLSHGKAPVSLGSFRPSVDVVMTSAARTYGDRVMGVLLTGMGRDGAQGMLEIK
KVRGRTIAQDESTCVVFGMPKEAIKLGAADKVSPLPEIPADILNML
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaataaaggttctgatagttgatgattccgcgctgatccgaaatttaatcagc
cgcctgttggaagagcagggtgaatttcaggttatcgggacggcacgcaacggcaaagag
gctttggagcgtattcctcagctgaagcctgatgttgtgactatggatgtggaaatgcct
gaaatggacgggttagcggcactcaggcgtctgatgcgccagaacccggttccggtagtt
atgttgagcgcccatacctttgccggggccaaggcgactattgacgctctggcctacggt
gcggtggattttgtcgcaaagccttccaaatcttctgaactcggcaagatggtttctgat
ttggcggtaaagctgaagatagcggctaaggttgccatgaagagaatgaccgggcggccg
gtggtttccagggtgaccaggccggcgacggcatcacgctcgggcaaaacagatctgttg
gttataggttcttctaccggcgggccggccgcgctgcagaccctggtgccggcactgccc
aaggattttccgtctgccgtggttctggtacagcattttccggttggtttcagccaggcc
ctggctgaaagcctgggccggagatgccggcttacagtgagtcatgccgttcacggggaa
gctgtgcggccgggtcatgttttggtggcgcctgccggtatggaatttacttttcagggc
aggccgggatctgtcacagtaaatctaagccacggcaaagctcctgtgtcgctgggcagt
tttcgcccttccgtggatgtggttatgacatcggcagccaggacgtacggggacagggta
atgggagttttattgaccggtatggggagagacggggcccagggtatgctggagattaaa
aaggttagaggcagaactattgctcaggatgaaagcacctgtgttgttttcggaatgccc
aaggaagctattaagttaggtgcggcggataaagtaagtcccttgccggaaattccggcg
gatattctgaatatgctgtaa

DBGET integrated database retrieval system