KEGG   Desulfotomaculum acetoxidans: Dtox_0814Help
Entry
Dtox_0814         CDS       T00986                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtox_0814
   01230 Biosynthesis of amino acids
    Dtox_0814
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtox_0814
   00030 Pentose phosphate pathway
    Dtox_0814
   00051 Fructose and mannose metabolism
    Dtox_0814
   00052 Galactose metabolism
    Dtox_0814
  Energy metabolism
   00680 Methane metabolism
    Dtox_0814
Enzymes [BR:dae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtox_0814
Protein phosphatases and associated proteins [BR:dae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dtox_0814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
829254..830216
Genome map
AA seq 320 aa AA seqDB search
MQRIAVLTSGGDSSGMNPAIRAVTRKAIYHGIEVIGIKRGYTGFIEGEMSLLNLGSVADI
IQRGGTMLFSARSEEFRTPEGRKKAFENVERFGIQGLIVIGGDGSFRGARQFHKEFGLPI
IGVPGTIDNDIVGTDYSIGFDTAINTVVDAINKIRDTATSHERTFIVEVMGRDTGFIALT
AGLAAGAESILIPEKPFSINDICHKLMQGHKRGKLHSIILVAEGASDSFDVASQIKEKTG
FDTKVIILGHLQRGGAPTAYERVIGSCMGAKAVELLRNGEVLKMVGMQAGKIVALDIEDS
ALKKKPIDMDMYDLANILSI
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
ttgcaaagaatagcagtattaaccagcgggggcgattcatccggcatgaacccggctatc
cgggcagtaacaaggaaagcaatttatcatgggatagaggttatcggcatcaaacgtggt
tatacaggttttattgagggggagatgtcacttttaaacctgggctcggtagcagacatc
atacagagaggcggaacaatgttattttcagccagatcggaagaattccggacacctgaa
ggacgaaaaaaggcttttgaaaatgttgagagatttggcatccagggcctaatcgttatt
ggcggtgacggctcctttcgtggtgcaaggcaatttcataaggaattcggtttgcctatc
attggtgtgccgggaacaattgataacgacatagttggcactgactactcaataggtttt
gacacggctataaatacagttgtagatgcaataaacaagatcagggatactgccacctcg
cacgagcgcacttttatagttgaagttatgggcagggatacgggttttatagcacttact
gccggtctggcggcaggtgccgaatcaatactgatcccggaaaagcctttttccataaat
gacatctgtcacaaactgatgcagggtcataaaagaggtaagctgcatagtattatactg
gtagcggaaggtgcttccgacagttttgatgtagccagccagattaaagaaaaaacaggt
tttgacactaaagtaattattttgggacacctgcaaagaggcggggcaccgactgcttat
gaaagggtaataggcagctgtatgggagcaaaggcagtggaattgttaagaaacggtgag
gttcttaagatggtcggcatgcaggccggcaagattgtggccctggatatagaagattca
gccttgaaaaagaaacccatagatatggatatgtatgatttggcaaacattttatcaatt
taa

DBGET integrated database retrieval system