KEGG   Desulfotomaculum acetoxidans: Dtox_0818Help
Entry
Dtox_0818         CDS       T00986                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dtox_0818
Enzymes [BR:dae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Dtox_0818
Exosome [BR:dae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtox_0818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
834269..836293
Genome map
AA seq 674 aa AA seqDB search
MNGFSVSDYDLYLFHEGTHYQSYKIFGAHIVEQNGQAGVRFTLWAPNAGSVRVVGDFNNW
QGDSHEMVKLDNSGIWSLFVPGLREGDLYKYQIITYQGEVFLKSDAYAFFSERRPGTASR
VASLHGYHWQDACWYKHKNSRSIYKCPMNIYEVHLGSWRCGLPETGENVYESDQNDRSLS
YRDLAQQLVDYVYEMGYTHIELLPVSEHPYDGSWGYQATGYFSVTSRYGNPHDFMYFVDC
CHQKGLGVILDWVPAHFCKDDCGLRRYDGSALYENENSLRGENVQWGTANFDFSKNEVWS
FLISNAYFWFDVYHIDGLRVDAVAYILYLDYCKQPGQWLPNKYNGPENLEAIEFMKKLNL
VIFENFPEALMIAEEATHWPMVTYPTYLGGLGYNYKWNMGWMNDILDYMKSDPLYRKDKH
SLLTFSLMYAFSENYVLPLSHDEVVHGKKSLINKMPGDYWQKFANLRLLYAYMMAHPGKK
LLFMGGEFGQFIEWSYKESLDWHLLVYEMHGKLHSYVKDLNHIYLDERCLWEEDGNWNGF
SWIDPHDSERSIITFIRRASNEEDFIIVVCNFTPVVRDSYLIGVPQAGVYQEVFNSDNEK
YGGSGQKNNRLIFADEFPYHGLPHSMRITIPPLAVVYLKRIKTKQSCTGRGKNAQGMCRD
ALSGREGQSFGDFN
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcttttccgttagtgattatgatttatatttatttcatgaaggtacgcactac
cagagctacaaaatttttggcgctcatattgttgagcagaacgggcaagccggtgtgcgc
ttcactttatgggccccaaatgccggaagtgtaagagttgtcggtgatttcaacaactgg
cagggtgattctcatgagatggtgaagctggacaactccggtatatggtcactttttgta
ccaggtttgcgagaaggagatttatataaataccaaataattacctatcaaggtgaggtc
tttttaaagtcggatgcttacgcttttttttcggagcgcaggccaggtactgcctcgagg
gttgcctcattgcacggttatcactggcaggatgcttgctggtataaacataaaaacagc
cgttcaatttataaatgtcccatgaatatatatgaagttcatttaggttcctggaggtgt
ggcttgcctgagacaggcgagaatgtgtatgaatcggatcaaaatgaccgttctttgagt
tacagggatctggctcagcaattagttgattatgtctatgagatgggttacactcatatt
gaactgctgccggtttctgagcacccttatgacggttcctggggctaccaggctacaggt
tatttttccgtaaccagcaggtatggaaatccccatgattttatgtattttgtagactgt
tgccatcaaaaaggactgggggttattttagactgggtaccggcacatttttgcaaggat
gactgtgggcttagaagatatgacggcagtgccctgtatgaaaacgagaacagcctgcgg
ggagagaacgttcagtggggtacagccaactttgatttttccaagaacgaggtttggagc
tttcttatctccaatgcttatttttggtttgatgtatatcatattgacggtttaagagtt
gatgcagtagcgtatatattatatctggattactgcaaacagccgggccaatggctgcct
aataagtacaacggcccggaaaacctggaagctattgagtttatgaaaaaattaaatctg
gttatatttgagaatttcccggaagctttaatgattgctgaagaagcaactcactggcct
atggtaacctatcccacttatctgggggggttgggttataattataaatggaatatgggt
tggatgaacgacatactggattatatgaaatccgatcctctatacagaaaagacaagcac
agtttattaacattttccttaatgtatgctttttctgaaaattatgtactccctctgtct
catgatgaggtagtccatggaaaaaaatctttaattaataagatgcccggtgactactgg
cagaaatttgccaatctaagacttctttacgcttatatgatggcccatcccggtaaaaag
ttactttttatgggcggagaattcgggcagtttattgagtggtcttataaagaaagtttg
gattggcacctgctggtttatgaaatgcatggtaaactgcattcttatgttaaggactta
aatcatatatatttagatgaaagatgtttatgggaagaggacggtaattggaacggtttc
tcctggatcgacccgcatgacagcgagagaagtattatcacttttatacgcagggccagc
aatgaggaggattttatcatagttgtatgcaactttacacctgtcgttagagacagttac
cttattggggtcccgcaggcgggggtctatcaggaagtgtttaacagtgataatgaaaaa
tacggtggatcaggacaaaagaataaccgcttgatttttgccgatgaattcccataccac
ggtttgccacattctatgagaataactattccacctttggctgttgtatatttgaagagg
ataaagacaaaacaatcatgcacagggaggggaaaaaatgcgcaaggaatgtgtcgcgat
gctcttagcgggagggaagggcagtcgtttggggattttaactaa

DBGET integrated database retrieval system