KEGG   Desulfotomaculum acetoxidans: Dtox_0911Help
Entry
Dtox_0911         CDS       T00986                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtox_0911
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtox_0911
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtox_0911
Enzymes [BR:dae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtox_0911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
922005..922823
Genome map
AA seq 272 aa AA seqDB search
MIEKRLAELRKNGEKALIPFVTAGDPDLPTTVKLVLSMAEAGADVIELGVPFTDPVADGP
AIQKASLRSLAGGTNLAGILDSVREIRQKSDIPLVLMTYYNPVFRFGIDKFVAEAAEAGV
NGLIMPDVPLEESGPLAKPAREKGIDLIPLVAPNSPEERIKKITAEAGGFIYCVSSLGVT
GVRKSIKTDIANFISRVKKYTELSVAVGFGISGPAQAAEMAAYCDAVIVGSALVNLIEAN
AASAELAEILAGKVRELKAAISRKEGEAVAAV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaagagattagctgagctgagaaaaaacggtgagaaagcgttgattcccttt
gttacggcaggggaccccgatctgccaactacagttaagctggttctgtctatggcggaa
gcgggcgctgatgtgattgaactgggagtgccttttaccgatccggtagctgacggaccg
gctattcaaaaagcctctttgcgttccctggccgggggtaccaatctggccggtattctt
gattcggtcagggaaatcaggcaaaaatctgatataccgctggtgcttatgacttattac
aacccggttttcaggtttggtatagataaatttgtcgccgaggcggcagaggcgggagtg
aacggcctgatcatgccggatgtgcccctggaggaatcaggacctctggcaaaaccggcc
agagaaaagggtattgacttgattcccctagtagctcccaacagtccggaagagagaatt
aagaaaatcacagccgaagcaggcgggtttatttattgtgtatcttctctgggtgttacc
ggggtgcgcaaatctatcaagactgacatagccaattttatcagccgtgttaaaaagtat
acggagctatccgtagcagtgggttttggcatttccggaccggctcaggcggctgaaatg
gctgcctattgcgatgcggttattgtgggcagtgccctggtcaacttgattgaagctaat
gctgcttccgctgaactggcggaaatactggccggaaaagttcgcgagttgaaagctgcc
atcagccggaaggagggtgaggcagttgccgcagtgtaa

DBGET integrated database retrieval system