KEGG   Desulfotomaculum acetoxidans: Dtox_0958Help
Entry
Dtox_0958         CDS       T00986                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtox_0958
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtox_0958
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dtox_0958
Enzymes [BR:dae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dtox_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(979246..980745)
Genome map
AA seq 499 aa AA seqDB search
MFYESTRGKHSSISSAEAIKLGIAPDGGLFVPSEPVTVSEELINRMTGLTYNQRAEEVLR
LYLTDFTPQELKDCVYNAYNEEKFDHGLITPLHKLSDKVFILELWHGPTCAFKDIALQIL
PHLLTRSAQKTGETDDIVILVATSGDTGKAALEGFKNVPQTKIVVFYPNEGVSQVQKQQM
VTQEGNNVSVVAVQGNFDDAQTGVKNIFGNAAAIDKFKRQHYKFSSANSINWGRLVPQVV
YYFSAYADLLKMEEINSGEAINFVVPTGNFGNILAAFYARCMGLPINRLICAANENNVLT
DFINSGIYDRERLFKKTLSPSMDILISSNLERLLYELTGHDSTKINEWMRELKERGKYKV
APDTYSKIKEIFWSDYASDQETLSTIKEIWKNYKYVMDTHTAVAQNVYAKYIAATGDKHK
TVIASTASPFKFNESVVKALLGEAAIQGKNEFELLNVLADTGSLAIPKGLQNLDSKPVLH
KQVVAKEEMLAAVENIILS
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgttttatgaaagtacgagaggaaagcactcctcaatatcatcagcagaagccataaaa
ctgggtattgccccggatggtggtctgtttgtacccagtgaaccggttactgtctctgaa
gagctaataaaccggatgacagggctaacctataatcagagggcagaggaagttctaagg
ctttatctgactgactttaccccccaggaattaaaggactgtgtttataacgcctataac
gaagaaaaatttgatcacgggttgattacgcctctgcacaagctttccgataaggttttt
atcctggagttatggcatgggccaacctgtgcttttaaagatatcgctttgcagattcta
cctcacctgctcaccagatctgctcagaaaaccggagagactgatgatatagtaatactg
gttgccacttcaggtgatacaggcaaagcggctttggaaggctttaaaaacgtgccccaa
accaaaatagttgtattttaccctaatgaaggtgtcagccaggtgcaaaaacaacaaatg
gtcacccaggaaggaaacaacgtcagtgtggttgccgttcagggcaattttgatgatgcc
caaaccggagtgaagaatatattcggcaatgccgcagccattgataaattcaagcggcag
cattacaagttttcctctgccaattctatcaattggggcaggttagtgccacaggtagtc
tattatttctctgcttatgccgatttattgaaaatggaagaaatcaacagcggagaagcc
atcaacttcgtggtgcccaccggcaatttcggcaacattctggccgccttctacgctcgt
tgtatgggcttgcctataaaccgtttaatctgcgcggccaacgaaaacaatgtgctaact
gattttatcaacagcggcatctatgaccgggaaagattattcaaaaaaaccctttctcct
tctatggatattttgatctccagtaatttggaaaggctgctttacgagctaaccggacat
gactcaactaaaattaatgaatggatgagggaactaaaagaaagaggcaaatacaaagtt
gccccggacacttactcaaaaataaaagaaatattctggtcagactatgccagcgatcag
gaaacgctgtccacaatcaaagagatctggaaaaattacaagtatgttatggatactcat
acggctgtagcgcaaaatgtctatgctaaatatattgcagccaccggcgataagcataaa
acagtgatagcttctactgccagtccctttaaatttaatgagagtgtagtcaaagctctc
ttaggcgaagcagctattcagggcaaaaacgagtttgaacttctcaacgtcctggcggat
acaggcagcctggctattcccaaaggtttgcaaaaccttgacagcaagcctgttttacat
aaacaagtagtagccaaagaagaaatgctggctgctgtagaaaatatcattcttagctga

DBGET integrated database retrieval system