KEGG   Desulfotomaculum acetoxidans: Dtox_1058Help
Entry
Dtox_1058         CDS       T00986                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dtox_1058
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Dtox_1058
Enzymes [BR:dae01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Dtox_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1084317..1085570
Genome map
AA seq 417 aa AA seqDB search
MAKYKISGGRRLEGTVQVSGSKNASLPILAACLLNGEVNTVYGIPRLRDIMVMQELLRYL
GGNVAWEGNVMTIDSKNIKSKKISEILMRRMRASNLVLGPLLSRFGRVEMAYPGGCQIGT
RPMDLHIKGIQALGAVTTEKHGYIIAEADELVGAEIHLDVPSVGATENIMMAAVFAKGQT
VIRNAAREPEIVDLQKFLNSIGADVRGAGSDTIKIRGVKLLKAGQHKVIPDRIEAGTHMV
AAAVTRGDITIENIIPDHMEPVTAKLKEAGIPVYVREDSIRVCCDRRPVPVDIKTMPYPG
FPTDMQPQLMVLMCIASGTGIVTETVFENRYKHVAELRRMGADIRVEGQTAIVKGVKCLS
GACVEATDLRAGAALVLAALAADNGSVIEKVMHIERGYESLESKYSSLGANIVRVHD
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
gtggcgaaatataaaatttctggtggcaggcgactggaaggaactgtacaggtgagcggt
tccaaaaatgcttccctgcctatattagccgcctgcttattaaatggggaagtaaacact
gtttacggcattcccaggttgcgtgatattatggtaatgcaggagttgttgcgttacctg
ggtggtaatgtagcctgggaaggcaatgtcatgactattgacagcaaaaatataaagagc
aaaaagatatcagaaattctcatgcgccgcatgagagcttcaaacctggtgttgggacca
cttttgagcaggtttggcagggtagaaatggcctatccgggaggctgccaaattgggacc
aggcctatggatttacacattaaaggaattcaagctttaggggcggtaaccactgaaaag
catggctatattattgcagaggcagatgaactggtaggagcggaaatacatcttgacgtg
cccagcgtgggagcaacagagaatataatgatggctgctgtatttgctaaaggacagact
gtgattcgcaatgcggccagagagccggaaattgttgatttgcagaagtttctcaatagt
atcggagctgatgtcagaggagccggatctgatacgataaaaataagaggtgtcaagctg
cttaaagccggacagcataaggttattcctgacagaattgaggcgggtacgcatatggta
gcagcggctgttacacgtggggatataactatagaaaatataatacctgatcatatggaa
cctgtaacggctaaattaaaggaagcgggtataccggtatatgtaagagaggacagtata
agagtttgctgtgacaggcgacctgttccggtagacataaagaccatgccatatccggga
tttccaaccgatatgcagccgcagttaatggttttgatgtgcatagcctccggtacaggc
attgtgactgagacagtttttgaaaaccgctacaagcatgtagcagaattgcgccggatg
ggggctgacattcgtgtagaaggacagaccgccattgttaaaggggttaaatgcctcagc
ggtgcctgtgtcgaagccaccgacctgagagccggtgcggcacttgttctggcggcattg
gcagcggataacgggtctgttatagaaaaagttatgcatattgagcgtggttatgagagc
ctggaaagtaaatactcatccctgggagcaaacattgtcagagttcacgattag

DBGET integrated database retrieval system