KEGG   Desulfotomaculum acetoxidans: Dtox_1188Help
Entry
Dtox_1188         CDS       T00986                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Dtox_1188
Enzymes [BR:dae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Dtox_1188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1210799..1211467
Genome map
AA seq 222 aa AA seqDB search
MSLATEEAKDNVVRVGHRMAQSRLVVGSWGNISTLVKKDKLVIITPSAVNCDNLHAHALI
TVDLEGNVVEGNLKPSTELKLHLAVYKSRPDVNAIVHTHSTYGCAMAVSRQALPPILEDM
AQLVGGPVPVAEYAPAGTAELAENCSHALGKLNAVFLANHGVIGVGRELEEAFQVCQIVE
RTAKVYILSGILGTPHVLTPEDVKSHHNYYLTCYRRPTNKNK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtctttggcaacagaagaagcaaaagataacgtggttagggtcggccatcgtatggct
caaagcaggctggtggtgggcagttggggtaatatttctactctggtcaagaaagataaa
ttggttattattactcccagtgcggttaactgcgataacctgcatgcccatgccctaatt
accgttgatttggagggaaatgtggttgaaggtaatctaaagccttcaactgaattaaaa
ctgcatttggcagtttataaatccaggccggatgttaacgcgatagttcatacgcatagc
acttacggttgtgccatggctgtatcccgtcaggctttgccgcctattctggaggacatg
gcccaactggtaggagggcctgtacctgtagccgagtatgcgcctgccggaacagcagaa
ttggcggaaaattgctcccatgcactcggtaaattaaatgcggtttttctggccaaccat
ggtgtgattggagtgggcagagaattggaagaagcttttcaggtttgccagattgttgag
agaacggccaaggtatatattttatccggaatattaggaacgccgcatgttttaaccccg
gaagatgtaaaatcccatcataattactatttgacgtgttatcgtcggccaacaaataag
aataagtga

DBGET integrated database retrieval system