KEGG   Desulfotomaculum acetoxidans: Dtox_1701Help
Entry
Dtox_1701         CDS       T00986                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dtox_1701
   00630 Glyoxylate and dicarboxylate metabolism
    Dtox_1701
   00640 Propanoate metabolism
    Dtox_1701
   00650 Butanoate metabolism
    Dtox_1701
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Dtox_1701
  Lipid metabolism
   00071 Fatty acid degradation
    Dtox_1701
   00072 Synthesis and degradation of ketone bodies
    Dtox_1701
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dtox_1701
   00310 Lysine degradation
    Dtox_1701
   00380 Tryptophan metabolism
    Dtox_1701
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Dtox_1701
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Dtox_1701
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Dtox_1701
Enzymes [BR:dae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Dtox_1701
Exosome [BR:dae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dtox_1701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1795893..1797074
Genome map
AA seq 393 aa AA seqDB search
MRDAVIVSAVRTAVGSFGGALKDIPAAELGAIVIAEALKRAGISGEQVDEVIFGNVLGAG
LGQNVSRQCSLKAGIPIEVPTYSVNKVCGSGLKTVGMAMQMIRAEEADIVVAGGTESMSM
APYLMEKARWGMRMGDGKVVDAMIKDGLWDAFNNYHMGITAENIAEKYDVSREDMDKFAL
SSQLKAVAAIDAGKFKDEIVPVPIPQRKGDPVLFDTDEYPKRGSTIEALTKLKPAFKKDG
RVTAGNASGINDGAAAFVIMSADKAKELGIKPMAVIRSFGAGGVDPSIMGMGPVPASKKA
LAKAGITVADLDVIEANEAFAAQALAVGRELGFPEEKLNPNGGAIAIGHPIGASGGRILV
TLLYELKRTGGKLGLATLCIGGGQGAALVVEMA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgatgcagtaatcgtcagtgcggttcgtactgctgtaggcagctttggcggagct
ttaaaggacattcctgccgcggagctgggtgccatcgttattgctgaggctttaaaacgg
gccgggattagcggtgagcaggttgatgaggttattttcggaaacgtattgggagcaggt
ctgggacagaatgtatcccgccagtgttcacttaaagcaggtattcctattgaggttccc
acatattcagtaaataaagtatgcggttccggtttgaaaacagttggcatggctatgcag
atgatacgcgctgaagaggctgatattgtagtggccggcggtactgaaagcatgagtatg
gctccgtatttaatggaaaaagcacgctggggcatgcgcatgggtgacggtaaagttgtt
gacgctatgatcaaagacggtctgtgggatgcttttaataattatcatatgggtattacc
gctgagaacatagcggagaaatatgatgtttcccgcgaagacatggacaagtttgccctg
tccagtcagttaaaggctgttgcagctattgatgcaggtaaatttaaagatgaaattgtg
ccggttcccattcctcaaagaaaaggtgatcccgtacttttcgatacagatgaatatccc
aagcgtggatcaacaattgaagctttaaccaagctgaagcctgcatttaagaaagacgga
cgtgtgaccgccggtaatgcctccggcattaatgatggtgcagcagcctttgttataatg
tctgcggataaagccaaagaacttggcattaagcctatggctgtgatcaggagcttcggt
gcgggtggcgtagatccctctattatgggtatgggtcctgttcccgcttctaaaaaagct
ttggctaaagccggtataaccgtagctgatctcgatgttattgaagcaaatgaggctttc
gcggcacaggctctggcagtgggcagagaacttggtttcccggaagaaaagcttaatccc
aacggtggggctattgctatcggtcacccgattggtgccagcggtggcaggattttagta
accctgctttatgaattaaagcgtaccggcggcaagcttggtttggctactttatgtatc
ggtggcggccagggagcggctctggttgttgagatggcctag

DBGET integrated database retrieval system