KEGG   Desulfotomaculum acetoxidans: Dtox_1709Help
Entry
Dtox_1709         CDS       T00986                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Dtox_1709
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtox_1709
   00620 Pyruvate metabolism
    Dtox_1709
   00650 Butanoate metabolism
    Dtox_1709
  Lipid metabolism
   00071 Fatty acid degradation
    Dtox_1709
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtox_1709
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtox_1709
   00626 Naphthalene degradation
    Dtox_1709
Enzymes [BR:dae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtox_1709
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Dtox_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1802536..1805139
Genome map
AA seq 867 aa AA seqDB search
MDVQKTSENKSVEEAIENLVEKALRARDNFLNYNQKQVDDIVRAMTLAGLNRHAELAKMA
VEETGRGVYEDKITKNIFATEYIYHSIKYHRTVGVINEDEEAGYLEIAEPVGVVAGVTPV
TNPTSTAMFKAIICMKTRNPVIFSFHPGAQKCSAAAVRTLLEAAVSAGAPENCISWIKEP
SVEATRALMNHPGVALVLATGGGGMVKSAYSTGKPALGVGPGNVPCYIEKSANLRRAVND
IILSKTFDNGMICASEQGVIADREIAREVRRLFTDYGCYFLSPEETGLLQRMVTGNGTCS
LNPDIVGHPAEEIAKTAGFAVPFGTKILIAQIDGVGKDHPLSREKLSPVLAYYEVNGYEE
GFKLCQEMIEFGGMGHTSVIHSENDELIRKFSRRMMTGRIVVNSPSSHGAIGDIYNTNMP
SLTLGCGSMGHNSTTSNVSAVNLINVKRVAYRREGMQWFKVPEKVYFSPGAVQYLSKMPG
VARAAIITDKIMVDLGYVDKVLYHLNKRSNKVAADVFSEVVPDPSLETVQSGVSMLKNLR
PDTLIALGGGSVMDAAKAMWLFYEHPDVEFDWLKLKFLDIRKRTYKYPKLGRKVKMVAIP
TTSGSGSEVTAFTVITDRGAEIKYPLADYELTPDVAIIDSEFTYSVPPDLTADTGIDVLT
HALEAYVSVMATDYSDAMAIKAMEMVFEYLPQVYRDGGNKKAREKMHNASCIAGMAFTNA
FLGICHSLAHKVGGEFRIPHGRINGVFLPHVIEYNAQKPSKFVSYPNYEYYMAPEKYRRA
AQLLGLASSSVEQGVASLVGAVRILMAEINLPATLMQLGINRKDYEAKIPSLAEKAFADQ
VTVTNPRLPLVAELEVLLRKGYGEINN
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggacgtacaaaagacttccgaaaacaaatcagtcgaagaagctattgagaacctggta
gaaaaggctttaagagccagggacaattttttaaattataaccagaaacaggtggatgat
attgtcagggctatgactttggccggtctgaacagacacgcggaactggctaaaatggcg
gtagaggaaaccggccggggtgtttatgaggacaaaataactaaaaacatctttgctact
gagtatatttaccatagtattaagtaccatagaacagttggtgtgattaatgaagatgaa
gaggccggttacctggaaatagctgaacctgtaggtgtggtagccggagtaacgcctgtt
accaaccctacttccacagctatgtttaaagctataatctgcatgaaaaccagaaacccg
gtgattttcagtttccatcccggtgctcagaagtgcagtgctgccgcggtgcggactttg
ctggaggccgctgtatcggcgggagcgcctgaaaactgtatcagttggattaaagagcct
tccgtagaagcaacgagagccttgatgaatcacccgggagttgccctggtattagctacc
gggggaggcgggatggtcaaatcggcttacagtacaggtaaaccggcactgggcgtgggt
ccgggcaatgtaccctgctacattgagaaatcggctaacttgcggcgagcggttaatgac
ataatcctgagcaagacttttgataacgggatgatttgcgcttctgagcagggagttatt
gcagacagagaaatagcaagggaagtcaggagactgtttacagactacggttgttatttt
ctttcaccggaggaaaccggactgctgcagaggatggttaccggaaacggtacctgctct
ttaaacccggacatagttggacaccctgctgaggaaattgccaaaacagccggttttgcc
gtgcctttcggtactaaaattctgatcgcgcaaattgacggggtgggcaaggatcaccct
ctgtccagagagaaattaagccctgtactggcttattacgaggtaaacgggtatgaggaa
ggctttaagctgtgccaggaaatgatagaatttggcggtatgggacatacttcggtgatt
cacagtgagaatgatgagctaatcaggaagttttcgcggcgcatgatgaccggcaggatt
gtggtcaactcaccttccagccatggcgctatcggggatatatataatactaatatgccg
tctctaacgctgggatgtggttcaatgggacataactcaactacctccaatgtcagtgcg
gttaatttgatcaacgttaagcgcgtggcctatcgccgggaaggcatgcagtggtttaaa
gttccggagaaagtatatttttcaccaggtgcggttcaatacctatccaagatgcccggg
gtggcaagggcagcaataattactgataagattatggtcgatttgggttatgttgataag
gtgctttatcacttgaacaaacgttccaataaagttgcggcggatgtcttcagcgaagtg
gtgccggatccgtcactggaaacagttcagagcggtgtgtccatgctcaagaacctgcgg
ccggatactctaattgcattgggcggcggttctgtaatggacgcggctaaagctatgtgg
ctattttatgagcacccggatgtagagtttgattggctcaaactaaagtttttagatata
aggaagagaacctataaatatcccaaactgggccgtaaggtgaaaatggtggcaataccc
accaccagcggcagcggttcagaggttacagcctttaccgtaattacggatagaggcgct
gagattaaatatcctttggccgactacgaattaactcctgatgtggccattattgactca
gagtttacttattcagtgccgccggatttgactgccgataccggcatagatgtactgact
catgcgctggaagcttatgtttcggtgatggctactgattatagcgatgccatggctata
aaagctatggagatggtatttgagtatttaccgcaggtgtaccgggacggaggcaataaa
aaggccagagaaaaaatgcataatgcctcctgcattgcgggaatggcttttaccaacgcc
tttttgggcatctgtcacagtttagcgcataaggtgggcggggagtttcgtatcccgcac
ggcaggattaacggagttttcttgcctcatgtgattgaatacaatgctcaaaaaccgtcc
aaatttgtttcctaccctaattacgaatattacatggctccggagaagtacaggcgggcc
gcgcagcttttgggactggcgtcctcaagcgttgaacagggtgtggcatctctggtcggg
gctgtgcgcatattaatggcggagattaacctgcctgcgacactgatgcagttgggtatt
aatcggaaggattatgaggctaaaataccctcactggcggaaaaggcttttgccgatcag
gtaaccgtgaccaacccgcggctgccgttggtggctgaactggaggttttattgagaaaa
ggctatggtgagattaataattaa

DBGET integrated database retrieval system