KEGG   Desulfotomaculum acetoxidans: Dtox_1757Help
Entry
Dtox_1757         CDS       T00986                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dtox_1757
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtox_1757
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtox_1757
Enzymes [BR:dae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtox_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1856674..1857882
Genome map
AA seq 402 aa AA seqDB search
MFEQFPDERGYYGTYGGMFVPETLMPALETLTSVYKEAMHDPVFLGELKFYFKNYVGRPS
LLYYAQGLTEYLGGAKIYLKREDLNHTGAHKINNTIGQALLAKRMGKRRIIAETGAGQHG
VATATAAALLDFDCVVYMGEEDTRRQALNVFRMELLGSKVVPVKTGSRTLKDAMNEAMRD
WVANIEDTYYVIGSVAGPHPYPAMVRDFQAVIGEETRAQIMEAEGRLPDYVIACVGGGSN
AMGMFHPFKEDTEVKLIGVEAAGHGTETDMHAATISKGIPGVLHGSLSYLLQDEYGQIAP
VHSVSAGLDYPGVGPEHSYLKDSGRVIYTSATDKEALDAFQILCRTDGIIPALESSHALA
EVIRLAPGLSADKVVVVNLSGRGDKDVQTVAEILGNLNQAAE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcaatttcctgatgaaagaggttattatggaacttatgggggcatgtttgtg
ccggaaactttaatgccggctctggagaccctgaccagtgtttacaaggaagctatgcat
gatccggtgtttttaggagaattgaaattttattttaaaaattatgtaggcagaccttct
ttgctctattatgcgcaaggactgaccgaatatctgggtggagccaagatatatttgaag
cgagaagatttgaatcataccggtgcacataagatcaacaacactattggccaggcatta
ctggctaaaagaatggggaaacgcaggattattgctgaaaccggtgccggtcagcatgga
gtggctacagctacagcagcagcacttttagactttgattgtgtagtatatatgggagaa
gaagatacccgcaggcaggctctaaatgtattccggatggaattgctggggtcaaaagta
gttccagtaaagactggaagccgtactttaaaagatgcaatgaatgaagcaatgcgtgat
tgggtggctaatattgaagatacttattatgttatcgggtccgtagcaggtccccaccca
tatcctgcgatggtaagggattttcaggctgttataggcgaggaaaccagggcgcagatt
atggaggcggaaggcagattgcccgattatgtgatagcctgtgtaggcggcggcagcaat
gctatgggtatgtttcatccttttaaggaagacacggaagttaagctcattggggtggag
gctgcaggacacggtacagaaactgatatgcatgcggctactatatctaaaggcatacct
ggtgttttacacggttcactaagctatttgctgcaagatgaatacggccagattgccccg
gtgcattccgtatctgccggtctggactatcccggagtgggtcctgaacacagctatttg
aaggattcaggacgggtgatttatactagtgctacagataaagaagcactggatgcgttt
caaattttgtgtcgtacagacggaattattccggccttggaaagttcccacgctttagct
gaggtgattcgactggcacccggtctttccgcggataaagttgttgtggtcaacctgtcg
ggacgtggtgacaaggatgttcagactgttgccgagatattgggtaacctgaaccaggca
gcagagtaa

DBGET integrated database retrieval system