KEGG   Desulfotomaculum acetoxidans: Dtox_1757Help
Entry
Dtox_1757         CDS       T00986                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
dae00260  Glycine, serine and threonine metabolism
dae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dae01100  Metabolic pathways
dae01110  Biosynthesis of secondary metabolites
dae01130  Biosynthesis of antibiotics
dae01230  Biosynthesis of amino acids
Module
dae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dtox_1757
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dtox_1757
Enzymes [BR:dae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dtox_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACV62614
UniProt: C8VX38
Position
1856674..1857882
Genome map
AA seq 402 aa AA seqDB search
MFEQFPDERGYYGTYGGMFVPETLMPALETLTSVYKEAMHDPVFLGELKFYFKNYVGRPS
LLYYAQGLTEYLGGAKIYLKREDLNHTGAHKINNTIGQALLAKRMGKRRIIAETGAGQHG
VATATAAALLDFDCVVYMGEEDTRRQALNVFRMELLGSKVVPVKTGSRTLKDAMNEAMRD
WVANIEDTYYVIGSVAGPHPYPAMVRDFQAVIGEETRAQIMEAEGRLPDYVIACVGGGSN
AMGMFHPFKEDTEVKLIGVEAAGHGTETDMHAATISKGIPGVLHGSLSYLLQDEYGQIAP
VHSVSAGLDYPGVGPEHSYLKDSGRVIYTSATDKEALDAFQILCRTDGIIPALESSHALA
EVIRLAPGLSADKVVVVNLSGRGDKDVQTVAEILGNLNQAAE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcaatttcctgatgaaagaggttattatggaacttatgggggcatgtttgtg
ccggaaactttaatgccggctctggagaccctgaccagtgtttacaaggaagctatgcat
gatccggtgtttttaggagaattgaaattttattttaaaaattatgtaggcagaccttct
ttgctctattatgcgcaaggactgaccgaatatctgggtggagccaagatatatttgaag
cgagaagatttgaatcataccggtgcacataagatcaacaacactattggccaggcatta
ctggctaaaagaatggggaaacgcaggattattgctgaaaccggtgccggtcagcatgga
gtggctacagctacagcagcagcacttttagactttgattgtgtagtatatatgggagaa
gaagatacccgcaggcaggctctaaatgtattccggatggaattgctggggtcaaaagta
gttccagtaaagactggaagccgtactttaaaagatgcaatgaatgaagcaatgcgtgat
tgggtggctaatattgaagatacttattatgttatcgggtccgtagcaggtccccaccca
tatcctgcgatggtaagggattttcaggctgttataggcgaggaaaccagggcgcagatt
atggaggcggaaggcagattgcccgattatgtgatagcctgtgtaggcggcggcagcaat
gctatgggtatgtttcatccttttaaggaagacacggaagttaagctcattggggtggag
gctgcaggacacggtacagaaactgatatgcatgcggctactatatctaaaggcatacct
ggtgttttacacggttcactaagctatttgctgcaagatgaatacggccagattgccccg
gtgcattccgtatctgccggtctggactatcccggagtgggtcctgaacacagctatttg
aaggattcaggacgggtgatttatactagtgctacagataaagaagcactggatgcgttt
caaattttgtgtcgtacagacggaattattccggccttggaaagttcccacgctttagct
gaggtgattcgactggcacccggtctttccgcggataaagttgttgtggtcaacctgtcg
ggacgtggtgacaaggatgttcagactgttgccgagatattgggtaacctgaaccaggca
gcagagtaa

DBGET integrated database retrieval system