KEGG   Desulfotomaculum acetoxidans: Dtox_2143Help
Entry
Dtox_2143         CDS       T00986                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dae  Desulfotomaculum acetoxidans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:dae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dtox_2143
   01230 Biosynthesis of amino acids
    Dtox_2143
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtox_2143
   00030 Pentose phosphate pathway
    Dtox_2143
   00051 Fructose and mannose metabolism
    Dtox_2143
   00052 Galactose metabolism
    Dtox_2143
  Energy metabolism
   00680 Methane metabolism
    Dtox_2143
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Dtox_2143
Enzymes [BR:dae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Dtox_2143
Protein phosphatases and associated proteins [BR:dae01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Dtox_2143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2319479..2320573)
Genome map
AA seq 364 aa AA seqDB search
MLSGKIKKIGVLTGGGDCPGLNAVIRAIVKTAASYSISVVGILDGFGGLIHNQTWKLTEK
DVMGILPRGGTILGTTNRDDPFNYPVIQDGKKVLADVSSQVKNNLHQNELDALIVIGGDG
TLKIALGFHQIGVPVIGVPKTIDNDLSATDQTFGFDTALTTATEAIDKLHTTAESHHRVM
VLEVMGRYAGWIALQSGLAGGADVILLPEIPFQMSKVIGKIKERRDHGKKFSIIVVAEGA
MPLGGHMVVQKHIEDSPDPVRLGGIGNLVGVQVEEGTGMETRVTVLGHLQRGGSPTAFDR
ILATRYGNGAIHLLNSKKFGEMVCLRTPDIKSVPLSEAVGELRQVSPEGQMVKTAEQIGI
CLGR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgttgtctggaaaaattaaaaaaataggcgttctcacaggtggcggagactgtcccggt
ctcaatgctgtaattagggccattgtaaaaactgctgccagttatagtatatcggttgta
ggtatactggacggttttgggggcctaattcataatcaaacctggaaattaacagaaaag
gatgttatggggattttgccgagaggcggaacgatactgggcactaccaatagagatgat
ccttttaattatccggttattcaagacgggaaaaaggttttggctgatgtgtccagtcaa
gttaaaaataatcttcaccaaaatgaacttgatgcgctgattgttataggcggagacggt
actctgaaaatagctctgggttttcaccagataggggtaccggtaattggtgtacccaaa
actattgataatgatctttcggccacggatcaaacctttggctttgacacggcattaact
actgctacagaggccattgacaaattacatacaacggcagagtcgcatcacagggtaatg
gtattggaagtcatggggcgttatgccggttggattgctttacaatcagggctggccggt
ggagcagatgtgattttattaccggagatacctttccaaatgtcaaaagtaataggtaaa
attaaagaacgcagggatcatggaaagaaattcagcattattgttgttgctgaaggtgca
atgcctctcggtggacatatggttgtacaaaagcatattgaagacagcccggatccggtt
cgtctgggtggcataggcaatttagtgggggtacaagttgaggaaggtacaggtatggag
accagagtaacagtactgggacacttacagagaggtggttcgcctacggcctttgatcgc
attttagccacacgttatggaaacggcgcaattcatttattaaacagcaaaaaatttggt
gaaatggtctgtctgcgcactccagatataaaatcagtgcctctgagcgaggctgtagga
gaattaagacaagtatcccctgaaggtcaaatggtaaaaaccgccgaacaaattggcatt
tgtttgggcagatag

DBGET integrated database retrieval system